KEGG   Homo sapiens (human): 8833Help
Entry
8833              CDS       T01001                                 

Gene name
GMPS, GATD7
Definition
(RefSeq) guanine monophosphate synthase
  KO
K01951  
GMP synthase (glutamine-hydrolysing) [EC:6.3.5.2]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    8833 (GMPS)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    8833 (GMPS)
Enzymes [BR:hsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.2  GMP synthase (glutamine-hydrolysing)
     8833 (GMPS)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C26: gamma-glutamyl hydrolase family
   8833 (GMPS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P49915(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
3q25.31
AA seq 693 aa AA seqDB search
MALCNGDSKLENAGGDLKDGHHHYEGAVVILDAGAQYGKVIDRRVRELFVQSEIFPLETP
AFAIKEQGFRAIIISGGPNSVYAEDAPWFDPAIFTIGKPVLGICYGMQMMNKVFGGTVHK
KSVREDGVFNISVDNTCSLFRGLQKEEVVLLTHGDSVDKVADGFKVVARSGNIVAGIANE
SKKLYGAQFHPEVGLTENGKVILKNFLYDIAGCSGTFTVQNRELECIREIKERVGTSKVL
VLLSGGVDSTVCTALLNRALNQEQVIAVHIDNGFMRKRESQSVEEALKKLGIQVKVINAA
HSFYNGTTTLPISDEDRTPRKRISKTLNMTTSPEEKRKIIGDTFVKIANEVIGEMNLKPE
EVFLAQGTLRPDLIESASLVASGKAELIKTHHNDTELIRKLREEGKVIEPLKDFHKDEVR
ILGRELGLPEELVSRHPFPGPGLAIRVICAEEPYICKDFPETNNILKIVADFSASVKKPH
TLLQRVKACTTEEDQEKLMQITSLHSLNAFLLPIKTVGVQGDCRSYSYVCGISSKDEPDW
ESLIFLARLIPRMCHNVNRVVYIFGPPVKEPPTDVTPTFLTTGVLSTLRQADFEAHNILR
ESGYAGKISQMPVILTPLHFDRDPLQKQPSCQRSVVIRTFITSDFMTGIPATPGNEIPVE
VVLKMVTEIKKIPGISRIMYDLTSKPPGTTEWE
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atggctctgtgcaacggagactccaagctggagaatgctggaggagaccttaaggatggc
caccaccactatgaaggagctgttgtcattctggatgctggtgctcagtacgggaaagtc
atagaccgaagagtgagggaactgttcgtgcagtctgaaattttccccttggaaacacca
gcatttgctataaaggaacaaggattccgtgctattatcatctctggaggacctaattct
gtgtatgctgaagatgctccctggtttgatccagcaatattcactattggcaagcctgtt
cttggaatttgctatggtatgcagatgatgaataaggtatttggaggtactgtgcacaaa
aaaagtgtcagagaagatggagttttcaacattagtgtggataatacatgttcattattc
aggggccttcagaaggaagaagttgttttgcttacacatggagatagtgtagacaaagta
gctgatggattcaaggttgtggcacgttctggaaacatagtagcaggcatagcaaatgaa
tctaaaaagttatatggagcacagttccaccctgaagttggccttacagaaaatggaaaa
gtaatactgaagaatttcctttatgatatagctggatgcagtggaaccttcaccgtgcag
aacagagaacttgagtgtattcgagagatcaaagagagagtaggcacgtcaaaagttttg
gttttactcagtggtggagtagactcaacagtttgtacagctttgctaaatcgtgctttg
aaccaagaacaagtcattgctgtgcacattgataatggctttatgagaaaacgagaaagc
cagtctgttgaagaggccctcaaaaagcttggaattcaggtcaaagtgataaatgctgct
cattctttctacaatggaacaacaaccctaccaatatcagatgaagatagaaccccacgg
aaaagaattagcaaaacgttaaatatgaccacaagtcctgaagagaaaagaaaaatcatt
ggggatacttttgttaagattgccaatgaagtaattggagaaatgaacttgaaaccagag
gaggttttccttgcccaaggtactttacggcctgatctaattgaaagtgcatcccttgtt
gcaagtggcaaagctgaactcatcaaaacccatcacaatgacacagagctcatcagaaag
ttgagagaggagggaaaagtaatagaacctctgaaagattttcataaagatgaagtgaga
attttgggcagagaacttggacttccagaagagttagtttccaggcatccatttccaggt
cctggcctggcaatcagagtaatatgtgctgaagaaccttatatttgtaaggactttcct
gaaaccaacaatattttgaaaatagtagctgatttttctgcaagtgttaaaaagccacat
accctattacagagagtcaaagcctgcacaacagaagaggatcaggagaagctgatgcaa
attaccagtctgcattcactgaatgccttcttgctgccaattaaaactgtaggtgtgcag
ggtgactgtcgttcctacagttacgtgtgtggaatctccagtaaagatgaacctgactgg
gaatcacttatttttctggctaggcttatacctcgcatgtgtcacaacgttaacagagtt
gtttatatatttggcccaccagttaaagaacctcctacagatgttactcccactttcttg
acaacaggggtgctcagtactttacgccaagctgattttgaggcccataacattctcagg
gagtctgggtatgctgggaaaatcagccagatgccggtgattttgacaccattacatttt
gatcgggacccacttcaaaagcagccttcatgccagagatctgtggttattcgaaccttt
attactagtgacttcatgactggtatacctgcaacacctggcaatgagatccctgtagag
gtggtattaaagatggtcactgagattaagaagattcctggtatttctcgaattatgtat
gacttaacatcaaagcccccaggaactactgagtgggagtaa

DBGET integrated database retrieval system