KEGG   Homo sapiens (human): 8835Help
Entry
8835              CDS       T01001                                 

Gene name
SOCS2, CIS2, Cish2, SOCS-2, SSI-2, SSI2, STATI2
Definition
suppressor of cytokine signaling 2
Orthology
K04695  
suppressor of cytokine signaling 2
Organism
hsa  Homo sapiens (human)
Pathway
Jak-STAT signaling pathway
Insulin signaling pathway
Prolactin signaling pathway
Type II diabetes mellitus
Module
ECS complex
Class
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:hsa04630]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:hsa04910]
Organismal Systems; Endocrine system; Prolactin signaling pathway [PATH:hsa04917]
Human Diseases; Endocrine and metabolic diseases; Type II diabetes mellitus [PATH:hsa04930]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q
AA seq 198 aa AA seqDB search
MTLRCLEPSGNGGEGTRSQWGTAGSAEEPSPQAARLAKALRELGQTGWYWGSMTVNEAKE
KLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFD
SVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWG
LPLPTRLKDYLEEYKFQV
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgcggtgccttgagccctccgggaatggcggggaagggacgcggagccagtgg
gggaccgcggggtcggcggaggagccatccccgcaggcggcgcgtctggcgaaggccctg
cgggagctcggtcagacaggatggtactggggaagtatgactgttaatgaagccaaagag
aaattaaaagaggcaccagaaggaactttcttgattagagatagctcgcattcagactac
ctactaacaatatctgttaaaacatcagctggaccaactaatcttcgaatcgaataccaa
gacggaaaattcagattggactctatcatatgtgtcaaatccaagcttaaacaatttgac
agtgtggttcatctgatcgactactatgttcagatgtgcaaggataagcggacaggtcca
gaagccccccggaacggcactgttcacctttatctgaccaaaccgctctacacgtcagca
ccatctctgcagcatctctgtaggctcaccattaacaaatgtaccggtgccatctgggga
ctgcctttaccaacaagactaaaagattacttggaagaatataaattccaggtataa

DBGET integrated database retrieval system