KEGG   Homo sapiens (human): 8837Help
Entry
8837              CDS       T01001                                 

Gene name
CFLAR, CASH, CASP8AP1, CLARP, Casper, FLAME, FLAME-1, FLAME1, FLIP, I-FLICE, MRIT, c-FLIP, c-FLIPL, c-FLIPR, c-FLIPS
Definition
(RefSeq) CASP8 and FADD like apoptosis regulator
  KO
K04724  
CASP8 and FADD-like apoptosis regulator
Organism
hsa  Homo sapiens (human)
Pathway
NF-kappa B signaling pathway
Autophagy - animal
Apoptosis
Necroptosis
TNF signaling pathway
Chagas disease (American trypanosomiasis)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    8837 (CFLAR)
   04668 TNF signaling pathway
    8837 (CFLAR)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    8837 (CFLAR)
  Cell growth and death
   04210 Apoptosis
    8837 (CFLAR)
   04217 Necroptosis
    8837 (CFLAR)
 Human Diseases
  Infectious diseases
   05142 Chagas disease (American trypanosomiasis)
    8837 (CFLAR)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C14: caspase family
   8837 (CFLAR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
O15519(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
2q33.1
AA seq 480 aa AA seqDB search
MSAEVIHQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKLSVGDLAELLY
RVRRFDLLKRILKMDRKAVETHLLRNPHLVSDYRVLMAEIGEDLDKSDVSSLIFLMKDYM
GRGKISKEKSFLDLVVELEKLNLVAPDQLDLLEKCLKNIHRIDLKTKIQKYKQSVQGAGT
SYRNVLQAAIQKSLKDPSNNFRLHNGRSKEQRLKEQLGAQQEPVKKSIQESEAFLPQSIP
EERYKMKSKPLGICLIIDCIGNETELLRDTFTSLGYEVQKFLHLSMHGISQILGQFACMP
EHRDYDSFVCVLVSRGGSQSVYGVDQTHSGLPLHHIRRMFMGDSCPYLAGKPKMFFIQNY
VVSEGQLEDSSLLEVDGPAMKNVEFKAQKRGLCTVHREADFFWSLCTADMSLLEQSHSSP
SLYLQCLSQKLRQERKRPLLDLHIELNGYMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctgaagtcatccatcaggttgaagaagcacttgatacagatgagaaggagatg
ctgctctttttgtgccgggatgttgctatagatgtggttccacctaatgtcagggacctt
ctggatattttacgggaaagaggtaagctgtctgtcggggacttggctgaactgctctac
agagtgaggcgatttgacctgctcaaacgtatcttgaagatggacagaaaagctgtggag
acccacctgctcaggaaccctcaccttgtttcggactatagagtgctgatggcagagatt
ggtgaggatttggataaatctgatgtgtcctcattaattttcctcatgaaggattacatg
ggccgaggcaagataagcaaggagaagagtttcttggaccttgtggttgagttggagaaa
ctaaatctggttgccccagatcaactggatttattagaaaaatgcctaaagaacatccac
agaatagacctgaagacaaaaatccagaagtacaagcagtctgttcaaggagcagggaca
agttacaggaatgttctccaagcagcaatccaaaagagtctcaaggatccttcaaataac
ttcaggctccataatgggagaagtaaagaacaaagacttaaggaacagcttggcgctcaa
caagaaccagtgaagaaatccattcaggaatcagaagcttttttgcctcagagcatacct
gaagagagatacaagatgaagagcaagcccctaggaatctgcctgataatcgattgcatt
ggcaatgagacagagcttcttcgagacaccttcacttccctgggctatgaagtccagaaa
ttcttgcatctcagtatgcatggtatatcccagattcttggccaatttgcctgtatgccc
gagcaccgagactacgacagctttgtgtgtgtcctggtgagccgaggaggctcccagagt
gtgtatggtgtggatcagactcactcagggctccccctgcatcacatcaggaggatgttc
atgggagattcatgcccttatctagcagggaagccaaagatgttttttattcagaactat
gtggtgtcagagggccagctggaggacagcagcctcttggaggtggatgggccagcgatg
aagaatgtggaattcaaggctcagaagcgagggctgtgcacagttcaccgagaagctgac
ttcttctggagcctgtgtactgcggacatgtccctgctggagcagtctcacagctcacca
tccctgtacctgcagtgcctctcccagaaactgagacaagaaagaaaacgcccactcctg
gatcttcacattgaactcaatggctacatgtatgattggaacagcagagtttctgccaag
gagaaatattatgtctggctgcagcacactctgagaaagaaacttatcctctcctacaca
taa

DBGET integrated database retrieval system