KEGG   Homo sapiens (human): 8837Help
Entry
8837              CDS       T01001                                 

Gene name
CFLAR, CASH, CASP8AP1, CLARP, Casper, FLAME, FLAME-1, FLAME1, FLIP, I-FLICE, MRIT, c-FLIP, c-FLIPL, c-FLIPR, c-FLIPS
Definition
CASP8 and FADD-like apoptosis regulator
Orthology
K04724  
CASP8 and FADD-like apoptosis regulator
Organism
hsa  Homo sapiens (human)
Pathway
NF-kappa B signaling pathway
Apoptosis
TNF signaling pathway
Chagas disease (American trypanosomiasis)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    8837 (CFLAR)
   04668 TNF signaling pathway
    8837 (CFLAR)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    8837 (CFLAR)
 Human Diseases
  Infectious diseases
   05142 Chagas disease (American trypanosomiasis)
    8837 (CFLAR)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C14: caspase family
   8837 (CFLAR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q33-q34
AA seq 480 aa AA seqDB search
MSAEVIHQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKLSVGDLAELLY
RVRRFDLLKRILKMDRKAVETHLLRNPHLVSDYRVLMAEIGEDLDKSDVSSLIFLMKDYM
GRGKISKEKSFLDLVVELEKLNLVAPDQLDLLEKCLKNIHRIDLKTKIQKYKQSVQGAGT
SYRNVLQAAIQKSLKDPSNNFRLHNGRSKEQRLKEQLGAQQEPVKKSIQESEAFLPQSIP
EERYKMKSKPLGICLIIDCIGNETELLRDTFTSLGYEVQKFLHLSMHGISQILGQFACMP
EHRDYDSFVCVLVSRGGSQSVYGVDQTHSGLPLHHIRRMFMGDSCPYLAGKPKMFFIQNY
VVSEGQLEDSSLLEVDGPAMKNVEFKAQKRGLCTVHREADFFWSLCTADMSLLEQSHSSP
SLYLQCLSQKLRQERKRPLLDLHIELNGYMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctgaagtcatccatcaggttgaagaagcacttgatacagatgagaaggagatg
ctgctctttttgtgccgggatgttgctatagatgtggttccacctaatgtcagggacctt
ctggatattttacgggaaagaggtaagctgtctgtcggggacttggctgaactgctctac
agagtgaggcgatttgacctgctcaaacgtatcttgaagatggacagaaaagctgtggag
acccacctgctcaggaaccctcaccttgtttcggactatagagtgctgatggcagagatt
ggtgaggatttggataaatctgatgtgtcctcattaattttcctcatgaaggattacatg
ggccgaggcaagataagcaaggagaagagtttcttggaccttgtggttgagttggagaaa
ctaaatctggttgccccagatcaactggatttattagaaaaatgcctaaagaacatccac
agaatagacctgaagacaaaaatccagaagtacaagcagtctgttcaaggagcagggaca
agttacaggaatgttctccaagcagcaatccaaaagagtctcaaggatccttcaaataac
ttcaggctccataatgggagaagtaaagaacaaagacttaaggaacagcttggcgctcaa
caagaaccagtgaagaaatccattcaggaatcagaagcttttttgcctcagagcatacct
gaagagagatacaagatgaagagcaagcccctaggaatctgcctgataatcgattgcatt
ggcaatgagacagagcttcttcgagacaccttcacttccctgggctatgaagtccagaaa
ttcttgcatctcagtatgcatggtatatcccagattcttggccaatttgcctgtatgccc
gagcaccgagactacgacagctttgtgtgtgtcctggtgagccgaggaggctcccagagt
gtgtatggtgtggatcagactcactcagggctccccctgcatcacatcaggaggatgttc
atgggagattcatgcccttatctagcagggaagccaaagatgttttttattcagaactat
gtggtgtcagagggccagctggaggacagcagcctcttggaggtggatgggccagcgatg
aagaatgtggaattcaaggctcagaagcgagggctgtgcacagttcaccgagaagctgac
ttcttctggagcctgtgtactgcggacatgtccctgctggagcagtctcacagctcacca
tccctgtacctgcagtgcctctcccagaaactgagacaagaaagaaaacgcccactcctg
gatcttcacattgaactcaatggctacatgtatgattggaacagcagagtttctgccaag
gagaaatattatgtctggctgcagcacactctgagaaagaaacttatcctctcctacaca
taa

DBGET integrated database retrieval system