KEGG   Homo sapiens (human): 8837Help
Entry
8837              CDS       T01001                                 

Gene name
CFLAR, CASH, CASP8AP1, CLARP, Casper, FLAME, FLAME-1, FLAME1, FLIP, I-FLICE, MRIT, c-FLIP, c-FLIPL, c-FLIPR, c-FLIPS
Definition
CASP8 and FADD-like apoptosis regulator
Orthology
K04724  
CASP8 and FADD-like apoptosis regulator
Organism
hsa  Homo sapiens (human)
Pathway
NF-kappa B signaling pathway
Apoptosis
TNF signaling pathway
Chagas disease (American trypanosomiasis)
Class
Environmental Information Processing; Signal transduction; NF-kappa B signaling pathway [PATH:hsa04064]
Environmental Information Processing; Signal transduction; TNF signaling pathway [PATH:hsa04668]
Cellular Processes; Cell growth and death; Apoptosis [PATH:hsa04210]
Human Diseases; Infectious diseases; Chagas disease (American trypanosomiasis) [PATH:hsa05142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q33-q34
AA seq 480 aa AA seqDB search
MSAEVIHQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKLSVGDLAELLY
RVRRFDLLKRILKMDRKAVETHLLRNPHLVSDYRVLMAEIGEDLDKSDVSSLIFLMKDYM
GRGKISKEKSFLDLVVELEKLNLVAPDQLDLLEKCLKNIHRIDLKTKIQKYKQSVQGAGT
SYRNVLQAAIQKSLKDPSNNFRLHNGRSKEQRLKEQLGAQQEPVKKSIQESEAFLPQSIP
EERYKMKSKPLGICLIIDCIGNETELLRDTFTSLGYEVQKFLHLSMHGISQILGQFACMP
EHRDYDSFVCVLVSRGGSQSVYGVDQTHSGLPLHHIRRMFMGDSCPYLAGKPKMFFIQNY
VVSEGQLEDSSLLEVDGPAMKNVEFKAQKRGLCTVHREADFFWSLCTADMSLLEQSHSSP
SLYLQCLSQKLRQERKRPLLDLHIELNGYMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctgaagtcatccatcaggttgaagaagcacttgatacagatgagaaggagatg
ctgctctttttgtgccgggatgttgctatagatgtggttccacctaatgtcagggacctt
ctggatattttacgggaaagaggtaagctgtctgtcggggacttggctgaactgctctac
agagtgaggcgatttgacctgctcaaacgtatcttgaagatggacagaaaagctgtggag
acccacctgctcaggaaccctcaccttgtttcggactatagagtgctgatggcagagatt
ggtgaggatttggataaatctgatgtgtcctcattaattttcctcatgaaggattacatg
ggccgaggcaagataagcaaggagaagagtttcttggaccttgtggttgagttggagaaa
ctaaatctggttgccccagatcaactggatttattagaaaaatgcctaaagaacatccac
agaatagacctgaagacaaaaatccagaagtacaagcagtctgttcaaggagcagggaca
agttacaggaatgttctccaagcagcaatccaaaagagtctcaaggatccttcaaataac
ttcaggctccataatgggagaagtaaagaacaaagacttaaggaacagcttggcgctcaa
caagaaccagtgaagaaatccattcaggaatcagaagcttttttgcctcagagcatacct
gaagagagatacaagatgaagagcaagcccctaggaatctgcctgataatcgattgcatt
ggcaatgagacagagcttcttcgagacaccttcacttccctgggctatgaagtccagaaa
ttcttgcatctcagtatgcatggtatatcccagattcttggccaatttgcctgtatgccc
gagcaccgagactacgacagctttgtgtgtgtcctggtgagccgaggaggctcccagagt
gtgtatggtgtggatcagactcactcagggctccccctgcatcacatcaggaggatgttc
atgggagattcatgcccttatctagcagggaagccaaagatgttttttattcagaactat
gtggtgtcagagggccagctggaggacagcagcctcttggaggtggatgggccagcgatg
aagaatgtggaattcaaggctcagaagcgagggctgtgcacagttcaccgagaagctgac
ttcttctggagcctgtgtactgcggacatgtccctgctggagcagtctcacagctcacca
tccctgtacctgcagtgcctctcccagaaactgagacaagaaagaaaacgcccactcctg
gatcttcacattgaactcaatggctacatgtatgattggaacagcagagtttctgccaag
gagaaatattatgtctggctgcagcacactctgagaaagaaacttatcctctcctacaca
taa

DBGET integrated database retrieval system