KEGG   Homo sapiens (human): 8843Help
Entry
8843              CDS       T01001                                 

Gene name
HCAR3, GPR109B, HCA3, HM74, PUMAG, Puma-g
Definition
(RefSeq) hydroxycarboxylic acid receptor 3
  KO
K08402  
G protein-coupled receptor 109
Organism
hsa  Homo sapiens (human)
Pathway
cAMP signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    8843 (HCAR3)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Other
   Nicotinic acid
    8843 (HCAR3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q24.31
AA seq 387 aa AA seqDB search
MNRHHLQDHFLEIDKKNCCVFRDDFIAKVLPPVLGLEFIFGLLGNGLALWIFCFHLKSWK
SSRIFLFNLAVADFLLIICLPFVMDYYVRRSDWKFGDIPCRLVLFMFAMNRQGSIIFLTV
VAVDRYFRVVHPHHALNKISNWTAAIISCLLWGITVGLTVHLLKKKLLIQNGTANVCISF
SICHTFRWHEAMFLLEFFLPLGIILFCSARIIWSLRQRQMDRHAKIKRAITFIMVVAIVF
VICFLPSVVVRIHIFWLLHTSGTQNCEVYRSVDLAFFITLSFTYMNSMLDPVVYYFSSPS
FPNFFSTLINRCLQRKITGEPDNNRSTSVELTGDPNKTRGAPEALIANSGEPWSPSYLGP
TSNNHSKKGHCHQEPASLEKQLGCCIE
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaatcggcaccatctgcaggatcactttctggaaatagacaagaagaactgctgtgtg
ttccgagatgacttcattgccaaggtgttgccgccggtgttggggctggagtttatcttt
gggcttctgggcaatggccttgccctgtggattttctgtttccacctcaagtcctggaaa
tccagccggattttcctgttcaacctggcagtagctgactttctactgatcatctgcctg
ccgttcgtgatggactactatgtgcggcgttcagactggaagtttggggacatcccttgc
cggctggtgctcttcatgtttgccatgaaccgccagggcagcatcatattcctcacggtg
gtggcggtagacaggtatttccgggtggtccatccccaccacgccctgaacaagatctcc
aattggacagcagccatcatctcttgccttctgtggggcatcactgttggcctaacagtc
cacctcctgaagaagaagttgctgatccagaatggcactgcaaatgtgtgcatcagcttc
agcatctgccataccttccggtggcacgaagctatgttcctcctggagttcttcctgccc
ctgggcatcatcctgttctgctcagccagaattatctggagcctgcggcagagacaaatg
gaccggcatgccaagatcaagagagccatcaccttcatcatggtggtggccatcgtcttt
gtcatctgcttccttcccagcgtggttgtgcggatccacatcttctggctcctgcacact
tcgggcacgcagaattgtgaagtgtaccgctcggtggacctggcgttctttatcactctc
agcttcacctacatgaacagcatgctggaccccgtggtgtactacttctccagcccatcc
tttcccaacttcttctccactttgatcaaccgctgcctccagaggaagataacaggtgag
ccagataataaccgcagcacgagcgtcgagctcacaggggaccccaacaaaaccagaggc
gctccagaggcgttaatcgccaactccggtgagccatggagcccctcttatctgggccca
acctcaaataaccattccaagaagggacattgtcaccaagaaccagcatctctggagaaa
cagttgggctgttgcatcgagtaa

DBGET integrated database retrieval system