KEGG   Homo sapiens (human): 8850Help
Entry
8850              CDS       T01001                                 

Gene name
KAT2B, CAF, P, P/CAF, PCAF
Definition
K(lysine) acetyltransferase 2B (EC:2.3.1.48)
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
hsa  Homo sapiens (human)
Pathway
Notch signaling pathway
Thyroid hormone signaling pathway
HTLV-I infection
Viral carcinogenesis
Class
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:hsa04330]
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:hsa04919]
Human Diseases; Cancers; Viral carcinogenesis [PATH:hsa05203]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:hsa05166]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3p24
AA seq 832 aa AA seqDB search
MSEAGGAGPGGCGAGAGAGAGPGALPPQPAALPPAPPQGSPCAAAAGGSGACGPATAVAA
AGTAEGPGGGGSARIAVKKAQLRSAPRAKKLEKLGVYSACKAEESCKCNGWKNPNPSPTP
PRADLQQIIVSLTESCRSCSHALAAHVSHLENVSEEEMNRLLGIVLDVEYLFTCVHKEED
ADTKQVYFYLFKLLRKSILQRGKPVVEGSLEKKPPFEKPSIEQGVNNFVQYKFSHLPAKE
RQTIVELAKMFLNRINYWHLEAPSQRRLRSPNDDISGYKENYTRWLCYCNVPQFCDSLPR
YETTQVFGRTLLRSVFTVMRRQLLEQARQEKDKLPLEKRTLILTHFPKFLSMLEEEVYSQ
NSPIWDQDFLSASSRTSQLGIQTVINPPPVAGTISYNSTSSSLEQPNAGSSSPACKASSG
LEANPGEKRKMTDSHVLEEAKKPRVMGDIPMELINEVMSTITDPAAMLGPETNFLSAHSA
RDEAARLEERRGVIEFHVVGNSLNQKPNKKILMWLVGLQNVFSHQLPRMPKEYITRLVFD
PKHKTLALIKDGRVIGGICFRMFPSQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKH
DILNFLTYADEYAIGYFKKQGFSKEIKIPKTKYVGYIKDYEGATLMGCELNPRIPYTEFS
VIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKDGVRQIPIESIPGIRETGWKPSGKEKSK
EPRDPDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNR
YYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSKIKEAGLIDK
NT seq 2499 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaggctggcggggccgggccgggcggctgcggggcaggagccggggcaggggcc
gggcccggggcgctgcccccgcagcctgcggcgcttccgcccgcgcccccgcagggctcc
ccctgcgccgctgccgccgggggctcgggcgcctgcggtccggcgacggcagtggctgca
gcgggcacggccgaaggaccgggaggcggtggctcggcccgaatcgccgtgaagaaagcg
caactacgctccgctccgcgggccaagaaactggagaaactcggagtgtactccgcctgc
aaggccgaggagtcttgtaaatgtaatggctggaaaaaccctaacccctcacccactccc
cccagagccgacctgcagcaaataattgtcagtctaacagaatcctgtcggagttgtagc
catgccctagctgctcatgtttcccacctggagaatgtgtcagaggaagaaatgaacaga
ctcctgggaatagtattggatgtggaatatctctttacctgtgtccacaaggaagaagat
gcagataccaaacaagtttatttctatctatttaagctcttgagaaagtctattttacaa
agaggaaaacctgtggttgaaggctctttggaaaagaaacccccatttgaaaaacctagc
attgaacagggtgtgaataactttgtgcagtacaaatttagtcacctgccagcaaaagaa
aggcaaacaatagttgagttggcaaaaatgttcctaaaccgcatcaactattggcatctg
gaggcaccatctcaacgaagactgcgatctcccaatgatgatatttctggatacaaagag
aactacacaaggtggctgtgttactgcaacgtgccacagttctgcgacagtctacctcgg
tacgaaaccacacaggtgtttgggagaacattgcttcgctcggtcttcactgttatgagg
cgacaactcctggaacaagcaagacaggaaaaagataaactgcctcttgaaaaacgaact
ctaatcctcactcatttcccaaaatttctgtccatgctagaagaagaagtatatagtcaa
aactctcccatctgggatcaggattttctctcagcctcttccagaaccagccagctaggc
atccaaacagttatcaatccacctcctgtggctgggacaatttcatacaattcaacctca
tcttcccttgagcagccaaacgcagggagcagcagtcctgcctgcaaagcctcttctgga
cttgaggcaaacccaggagaaaagaggaaaatgactgattctcatgttctggaggaggcc
aagaaaccccgagttatgggggatattccgatggaattaatcaacgaggttatgtctacc
atcacggaccctgcagcaatgcttggaccagagaccaattttctgtcagcacactcggcc
agggatgaggcggcaaggttggaagagcgcaggggtgtaattgaatttcacgtggttggc
aattccctcaaccagaaaccaaacaagaagatcctgatgtggctggttggcctacagaac
gttttctcccaccagctgccccgaatgccaaaagaatacatcacacggctcgtctttgac
ccgaaacacaaaacccttgctttaattaaagatggccgtgttattggtggtatctgtttc
cgtatgttcccatctcaaggattcacagagattgtcttctgtgctgtaacctcaaatgag
caagtcaagggctatggaacacacctgatgaatcatttgaaagaatatcacataaagcat
gacatcctgaacttcctcacatatgcagatgaatatgcaattggatactttaagaaacag
ggtttctccaaagaaattaaaatacctaaaaccaaatatgttggctatatcaaggattat
gaaggagccactttaatgggatgtgagctaaatccacggatcccgtacacagaattttct
gtcatcattaaaaagcagaaggagataattaaaaaactgattgaaagaaaacaggcacaa
attcgaaaagtttaccctggactttcatgttttaaagatggagttcgacagattcctata
gaaagcattcctggaattagagagacaggctggaaaccgagtggaaaagagaaaagtaaa
gagcccagagaccctgaccagctttacagcacgctcaagagcatcctccagcaggtgaag
agccatcaaagcgcttggcccttcatggaacctgtgaagagaacagaagctccaggatat
tatgaagttataaggttccccatggatctgaaaaccatgagtgaacgcctcaagaatagg
tactacgtgtctaagaaattattcatggcagacttacagcgagtctttaccaattgcaaa
gagtacaacccccctgagagtgaatactacaaatgtgccaatatcctggagaaattcttc
ttcagtaaaattaaggaagctggattaattgacaagtga

DBGET integrated database retrieval system