KEGG   Homo sapiens (human): 8850Help
Entry
8850              CDS       T01001                                 

Gene name
KAT2B, CAF, P/CAF, PCAF
Definition
K(lysine) acetyltransferase 2B (EC:2.3.1.48)
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
hsa  Homo sapiens (human)
Pathway
Notch signaling pathway
Thyroid hormone signaling pathway
HTLV-I infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    8850 (KAT2B)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    8850 (KAT2B)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    8850 (KAT2B)
  Infectious diseases
   05166 HTLV-I infection
    8850 (KAT2B)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     8850 (KAT2B)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     8850 (KAT2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3p24
AA seq 832 aa AA seqDB search
MSEAGGAGPGGCGAGAGAGAGPGALPPQPAALPPAPPQGSPCAAAAGGSGACGPATAVAA
AGTAEGPGGGGSARIAVKKAQLRSAPRAKKLEKLGVYSACKAEESCKCNGWKNPNPSPTP
PRADLQQIIVSLTESCRSCSHALAAHVSHLENVSEEEMNRLLGIVLDVEYLFTCVHKEED
ADTKQVYFYLFKLLRKSILQRGKPVVEGSLEKKPPFEKPSIEQGVNNFVQYKFSHLPAKE
RQTIVELAKMFLNRINYWHLEAPSQRRLRSPNDDISGYKENYTRWLCYCNVPQFCDSLPR
YETTQVFGRTLLRSVFTVMRRQLLEQARQEKDKLPLEKRTLILTHFPKFLSMLEEEVYSQ
NSPIWDQDFLSASSRTSQLGIQTVINPPPVAGTISYNSTSSSLEQPNAGSSSPACKASSG
LEANPGEKRKMTDSHVLEEAKKPRVMGDIPMELINEVMSTITDPAAMLGPETNFLSAHSA
RDEAARLEERRGVIEFHVVGNSLNQKPNKKILMWLVGLQNVFSHQLPRMPKEYITRLVFD
PKHKTLALIKDGRVIGGICFRMFPSQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKH
DILNFLTYADEYAIGYFKKQGFSKEIKIPKTKYVGYIKDYEGATLMGCELNPRIPYTEFS
VIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKDGVRQIPIESIPGIRETGWKPSGKEKSK
EPRDPDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNR
YYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSKIKEAGLIDK
NT seq 2499 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaggctggcggggccgggccgggcggctgcggggcaggagccggggcaggggcc
gggcccggggcgctgcccccgcagcctgcggcgcttccgcccgcgcccccgcagggctcc
ccctgcgccgctgccgccgggggctcgggcgcctgcggtccggcgacggcagtggctgca
gcgggcacggccgaaggaccgggaggcggtggctcggcccgaatcgccgtgaagaaagcg
caactacgctccgctccgcgggccaagaaactggagaaactcggagtgtactccgcctgc
aaggccgaggagtcttgtaaatgtaatggctggaaaaaccctaacccctcacccactccc
cccagagccgacctgcagcaaataattgtcagtctaacagaatcctgtcggagttgtagc
catgccctagctgctcatgtttcccacctggagaatgtgtcagaggaagaaatgaacaga
ctcctgggaatagtattggatgtggaatatctctttacctgtgtccacaaggaagaagat
gcagataccaaacaagtttatttctatctatttaagctcttgagaaagtctattttacaa
agaggaaaacctgtggttgaaggctctttggaaaagaaacccccatttgaaaaacctagc
attgaacagggtgtgaataactttgtgcagtacaaatttagtcacctgccagcaaaagaa
aggcaaacaatagttgagttggcaaaaatgttcctaaaccgcatcaactattggcatctg
gaggcaccatctcaacgaagactgcgatctcccaatgatgatatttctggatacaaagag
aactacacaaggtggctgtgttactgcaacgtgccacagttctgcgacagtctacctcgg
tacgaaaccacacaggtgtttgggagaacattgcttcgctcggtcttcactgttatgagg
cgacaactcctggaacaagcaagacaggaaaaagataaactgcctcttgaaaaacgaact
ctaatcctcactcatttcccaaaatttctgtccatgctagaagaagaagtatatagtcaa
aactctcccatctgggatcaggattttctctcagcctcttccagaaccagccagctaggc
atccaaacagttatcaatccacctcctgtggctgggacaatttcatacaattcaacctca
tcttcccttgagcagccaaacgcagggagcagcagtcctgcctgcaaagcctcttctgga
cttgaggcaaacccaggagaaaagaggaaaatgactgattctcatgttctggaggaggcc
aagaaaccccgagttatgggggatattccgatggaattaatcaacgaggttatgtctacc
atcacggaccctgcagcaatgcttggaccagagaccaattttctgtcagcacactcggcc
agggatgaggcggcaaggttggaagagcgcaggggtgtaattgaatttcacgtggttggc
aattccctcaaccagaaaccaaacaagaagatcctgatgtggctggttggcctacagaac
gttttctcccaccagctgccccgaatgccaaaagaatacatcacacggctcgtctttgac
ccgaaacacaaaacccttgctttaattaaagatggccgtgttattggtggtatctgtttc
cgtatgttcccatctcaaggattcacagagattgtcttctgtgctgtaacctcaaatgag
caagtcaagggctatggaacacacctgatgaatcatttgaaagaatatcacataaagcat
gacatcctgaacttcctcacatatgcagatgaatatgcaattggatactttaagaaacag
ggtttctccaaagaaattaaaatacctaaaaccaaatatgttggctatatcaaggattat
gaaggagccactttaatgggatgtgagctaaatccacggatcccgtacacagaattttct
gtcatcattaaaaagcagaaggagataattaaaaaactgattgaaagaaaacaggcacaa
attcgaaaagtttaccctggactttcatgttttaaagatggagttcgacagattcctata
gaaagcattcctggaattagagagacaggctggaaaccgagtggaaaagagaaaagtaaa
gagcccagagaccctgaccagctttacagcacgctcaagagcatcctccagcaggtgaag
agccatcaaagcgcttggcccttcatggaacctgtgaagagaacagaagctccaggatat
tatgaagttataaggttccccatggatctgaaaaccatgagtgaacgcctcaagaatagg
tactacgtgtctaagaaattattcatggcagacttacagcgagtctttaccaattgcaaa
gagtacaacccccctgagagtgaatactacaaatgtgccaatatcctggagaaattcttc
ttcagtaaaattaaggaagctggattaattgacaagtga

DBGET integrated database retrieval system