KEGG   Homo sapiens (human): 8854Help
Entry
8854              CDS       T01001                                 

Gene name
ALDH1A2, RALDH(II), RALDH2, RALDH2-T
Definition
aldehyde dehydrogenase 1 family, member A2 (EC:1.2.1.36)
Orthology
K07249  
retinal dehydrogenase [EC:1.2.1.36]
Organism
hsa  Homo sapiens (human)
Pathway
Retinol metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    8854 (ALDH1A2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.36  retinal dehydrogenase
     8854 (ALDH1A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
15q21.3
AA seq 497 aa AA seqDB search
MKNQCETVWLKSPIKLKLIFINNEWQNSESGRVFPVYNPATGEQVCEVQEADKADIDKAV
QAARLAFSLGSVWRRMDASERGRLLDKLADLVERDRAVLATMESLNGGKPFLQAFYVDLQ
GVIKTFRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFAWKIAPAL
CCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVINILPGYGPTAGAAIASHIGIDKIAF
TGSTEVGKLIQEAAGRSNLKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQCCT
AGSRIFVEESIYEEFVRRSVERAKRRVVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAE
GAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNS
DFGLVAAVFTNDINKALTVSSAMQAGTVWINCYNALNAQSPFGGFKMSGNGREMGEFGLR
EYSEVKTVTVKIPQKNS
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatcagtgtgagactgtttggttaaaatccccaataaaactgaaactgatcttt
ataaacaacgagtggcagaactcagagagtgggagagtgttccctgtctataatccagcc
acaggagaacaggtgtgtgaagttcaagaagcagacaaggcagatatagacaaagcagtg
caggcagcccgcctggctttctctcttggttcagtgtggagaaggatggatgcttcagaa
aggggacgtctgttggataagcttgcagacttggtggaacgggacagggcagttcttgca
accatggaatccctaaatggtggcaaaccattcctgcaagctttttatgtggatttgcag
ggcgtcatcaaaacctttcgatattacgcaggctgggctgataaaattcatgggatgacc
attcctgtagatggagactattttacctttacaagacatgaacccattggagtgtgtgga
cagatcatcccatggaacttccccctgctgatgtttgcctggaaaatagctccagctttg
tgctgtggcaatacagtagttattaagccagcagagcaaacaccactcagtgcactctac
atgggagccctcatcaaggaggctggctttcctcccggggtcatcaatattttgccagga
tatgggccaacggctggggcagcaatagcttctcacattggcatagacaagattgcattc
acagggtctactgaggttggaaagcttatccaagaagcagctggaagaagtaatttgaag
agagtaactctggaacttggaggcaaaagtcctaatattatttttgctgatgctgacttg
gactatgctgtggagcaggcccaccagggtgtgttcttcaatcaaggtcagtgctgcact
gcaggctctcgcatcttcgtggaggagtccatctatgaggagtttgtgagaagaagcgtg
gagcgggccaagaggcgcgtagtggggagtccctttgaccccaccactgagcagggtccc
cagattgataagaaacagtacaacaagatcttggaactcatccagagtggtgtggctgag
ggcgccaagctggaatgtggaggcaaaggactgggccgaaaggggtttttcattgagccc
acagtgttttccaacgtcactgatgatatgcggattgccaaggaggagatctttggccct
gttcaggaaattttgagatttaagacgatggatgaagttatcgaaagagccaataactca
gactttggactcgtagcagctgtctttactaatgacatcaacaaggccctcacagtgtct
tctgcaatgcaagctgggactgtttggatcaattgttacaatgccttaaatgcccagagc
ccctttgggggattcaagatgtctggaaatgggagagaaatgggagaatttggcttgcgg
gagtactcagaagttaagacggtgacagtaaagatcccccagaagaactcctaa

DBGET integrated database retrieval system