KEGG   Homo sapiens (human): 8856Help
Entry
8856              CDS       T01001                                 

Gene name
NR1I2, BXR, ONR1, PAR, PAR1, PAR2, PARq, PRR, PXR, SAR, SXR
Definition
(RefSeq) nuclear receptor subfamily 1 group I member 2
  KO
K08540  
pregnane X receptor
Organism
hsa  Homo sapiens (human)
Brite
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 thyroid hormone-like
    8856 (NR1I2)
Nuclear receptors [BR:hsa03310]
 1. Thyroid hormone like
  1I. Vitamin D3 like receptor
   8856 (NR1I2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3q12-q13.3
AA seq 434 aa AA seqDB search
MEVRPKESWNHADFVHCEDTESVPGKPSVNADEEVGGPQICRVCGDKATGYHFNVMTCEG
CKGFFRRAMKRNARLRCPFRKGACEITRKTRRQCQACRLRKCLESGMKKEMIMSDEAVEE
RRALIKRKKSERTGTQPLGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVLSS
GCELPESLQAPSREEAAKWSQVRKDLCSLKVSLQLRGEDGSVWNYKPPADSGGKEIFSLL
PHMADMSTYMFKGIISFAKVISYFRDLPIEDQISLLKGAAFELCQLRFNTVFNAETGTWE
CGRLSYCLEDTAGGFQQLLLEPMLKFHYMLKKLQLHEEEYVLMQAISLFSPDRPGVLQHR
VVDQLQEQFAITLKSYIECNRPQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPF
ATPLMQELFGITGS
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
ctggaggtgagacccaaagaaagctggaaccatgctgactttgtacactgtgaggacaca
gagtctgttcctggaaagcccagtgtcaacgcagatgaggaagtcggaggtccccaaatc
tgccgtgtatgtggggacaaggccactggctatcacttcaatgtcatgacatgtgaagga
tgcaagggctttttcaggagggccatgaaacgcaacgcccggctgaggtgccccttccgg
aagggcgcctgcgagatcacccggaagacccggcgacagtgccaggcctgccgcctgcgc
aagtgcctggagagcggcatgaagaaggagatgatcatgtccgacgaggccgtggaggag
aggcgggccttgatcaagcggaagaaaagtgaacggacagggactcagccactgggagtg
caggggctgacagaggagcagcggatgatgatcagggagctgatggacgctcagatgaaa
acctttgacactaccttctcccatttcaagaatttccggctgccaggggtgcttagcagt
ggctgcgagttgccagagtctctgcaggccccatcgagggaagaagctgccaagtggagc
caggtccggaaagatctgtgctctttgaaggtctctctgcagctgcggggggaggatggc
agtgtctggaactacaaacccccagccgacagtggcgggaaagagatcttctccctgctg
ccccacatggctgacatgtcaacctacatgttcaaaggcatcatcagctttgccaaagtc
atctcctacttcagggacttgcccatcgaggaccagatctccctgctgaagggggccgct
ttcgagctgtgtcaactgagattcaacacagtgttcaacgcggagactggaacctgggag
tgtggccggctgtcctactgcttggaagacactgcaggtggcttccagcaacttctactg
gagcccatgctgaaattccactacatgctgaagaagctgcagctgcatgaggaggagtat
gtgctgatgcaggccatctccctcttctccccagaccgcccaggtgtgctgcagcaccgc
gtggtggaccagctgcaggagcaattcgccattactctgaagtcctacattgaatgcaat
cggccccagcctgctcataggttcttgttcctgaagatcatggctatgctcaccgagctc
cgcagcatcaatgctcagcacacccagcggctgctgcgcatccaggacatacaccccttt
gctacgcccctcatgcaggagttgttcggcatcacaggtagctga

DBGET integrated database retrieval system