KEGG   Homo sapiens (human): 8861Help
Entry
8861              CDS       T01001                                 

Gene name
LDB1, CLIM2, NLI
Definition
(RefSeq) LIM domain binding 1
  KO
K15617  
LIM domain-binding protein 1
Organism
hsa  Homo sapiens (human)
Pathway
Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    8861 (LDB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10q24-q25
AA seq 411 aa AA seqDB search
MSVGCACPGCSSKSFKLYSPKEPPNGNAFPPFHPGTMLDRDVGPTPMYPPTYLEPGIGRH
TPYGNQTDYRIFELNKRLQNWTEECDNLWWDAFTTEFFEDDAMLTITFCLEDGPKRYTIG
RTLIPRYFRSIFEGGATELYYVLKHPKEAFHSNFVSLDCDQGSMVTQHGKPMFTQVCVEG
RLYLEFMFDDMMRIKTWHFSIRQHRELIPRSILAMHAQDPQMLDQLSKNITRCGLSNSTL
NYLRLCVILEPMQELMSRHKTYSLSPRDCLKTCLFQKWQRMVAPPAEPTRQQPSKRRKRK
MSGGSTMSSGGGNTNNSNSKKKSPASTFALSSQVPDVMVVGEPTLMGGEFGDEDERLITR
LENTQFDAANGIDDEDSFNNSPALGANSPWNSKPPSSQESKSENPTSQASQ
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtgggctgtgcctgtcctggttgttcctcaaagtcattcaagctgtactcgccg
aaggagcccccgaacggcaacgcctttccccccttccatcccggcaccatgctggatagg
gatgtgggcccaactcccatgtatccgcctacatacctggagccagggattgggaggcac
acaccatatggcaaccaaactgactacagaatatttgagcttaacaaacggcttcagaac
tggacagaggagtgtgacaatctctggtgggatgcattcacgactgagttctttgaggat
gatgccatgttgaccatcactttctgcctggaggatggaccaaagagatataccattggc
cggaccctgatcccacgctacttccgcagcatctttgaggggggtgctacggagctgtac
tatgttcttaagcaccccaaggaggcattccacagcaactttgtgtccctcgactgtgac
cagggcagcatggtgacccagcatggcaagcccatgttcacccaggtgtgtgtggagggc
cggttgtacctggagttcatgtttgacgacatgatgcggataaagacgtggcacttcagc
atccggcagcaccgagagctcatcccccgcagcatccttgccatgcatgcccaagacccc
cagatgttggatcagctctccaaaaacatcactcggtgtgggctgtccaattccactctc
aactacctccgactctgtgtgatactcgagcccatgcaagagctcatgtcacgccacaag
acctacagcctcagcccccgcgactgcctcaagacctgccttttccagaagtggcagcgc
atggtagcaccccctgcggagcccacacgtcagcagcccagcaaacggcggaaacggaag
atgtcagggggcagcaccatgagctctggtggtggcaacaccaacaacagcaacagcaag
aagaagagcccagctagcaccttcgccctctccagccaggtacctgatgtgatggtggtg
ggggagcccaccctgatgggcggggagttcggggacgaggacgagaggctcatcacccgg
ctggagaacacccagtttgacgcagccaacggcattgacgacgaggacagctttaacaac
tcccctgcactgggcgccaacagcccctggaacagcaagcctccgtccagccaagaaagc
aaatcggagaaccccacgtcacaggcctcccagtaa

DBGET integrated database retrieval system