KEGG   Homo sapiens (human): 8867Help
Entry
8867              CDS       T01001                                 

Gene name
SYNJ1, EIEE53, INPP5G, PARK20
Definition
(RefSeq) synaptojanin 1
  KO
K20279  
synaptojanin [EC:3.1.3.36]
Organism
hsa  Homo sapiens (human)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Disease
H01600  
Parkinsonian syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    8867 (SYNJ1)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    8867 (SYNJ1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.36  phosphoinositide 5-phosphatase
     8867 (SYNJ1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Inositol 5-phosphatases
    8867 (SYNJ1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
O43426(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
21q22.11
AA seq 1612 aa AA seqDB search
MRKRWACWSGSDAPGGCGGGCGRRRRRSRRKRAASEERRMAFSKGFRIYHKLDPPPFSLI
VETRHKEECLMFESGAVAVLSSAEKEAIKGTYSKVLDAYGLLGVLRLNLGDTMLHYLVLV
TGCMSVGKIQESEVFRVTSTEFISLRIDSSDEDRISEVRKVLNSGNFYFAWSASGISLDL
SLNAHRSMQEQTTDNRFFWNQSLHLHLKHYGVNCDDWLLRLMCGGVEIRTIYAAHKQAKA
CLISRLSCERAGTRFNVRGTNDDGHVANFVETEQVVYLDDSVSSFIQIRGSVPLFWEQPG
LQVGSHRVRMSRGFEANAPAFDRHFRTLKNLYGKQIIVNLLGSKEGEHMLSKAFQSHLKA
SEHAADIQMVNFDYHQMVKGGKAEKLHSVLKPQVQKFLDYGFFYFNGSEVQRCQSGTVRT
NCLDCLDRTNSVQAFLGLEMLAKQLEALGLAEKPQLVTRFQEVFRSMWSVNGDSISKIYA
GTGALEGKAKLKDGARSVTRTIQNNFFDSSKQEAIDVLLLGNTLNSDLADKARALLTTGS
LRVSEQTLQSASSKVLKSMCENFYKYSKPKKIRVCVGTWNVNGGKQFRSIAFKNQTLTDW
LLDAPKLAGIQEFQDKRSKPTDIFAIGFEEMVELNAGNIVSASTTNQKLWAVELQKTISR
DNKYVLLASEQLVGVCLFVFIRPQHAPFIRDVAVDTVKTGMGGATGNKGAVAIRMLFHTT
SLCFVCSHFAAGQSQVKERNEDFIEIARKLSFPMGRMLFSHDYVFWCGDFNYRIDLPNEE
VKELIRQQNWDSLIAGDQLINQKNAGQVFRGFLEGKVTFAPTYKYDLFSDDYDTSEKCRT
PAWTDRVLWRRRKWPFDRSAEDLDLLNASFQDESKILYTWTPGTLLHYGRAELKTSDHRP
VVALIDIDIFEVEAEERQNIYKEVIAVQGPPDGTVLVSIKSSLPENNFFDDALIDELLQQ
FASFGEVILIRFVEDKMWVTFLEGSSALNVLSLNGKELLNRTITIALKSPDWIKNLEEEM
SLEKISIALPSSTSSTLLGEDAEVAADFDMEGDVDDYSAEVEELLPQHLQPSSSSGLGTS
PSSSPRTSPCQSPTISEGPVPSLPIRPSRAPSRTPGPPSAQSSPIDAQPATPLPQKDPAQ
PLEPKRPPPPRPVAPPTRPAPPQRPPPPSGARSPAPTRKEFGGIGAPPSPGVARREMEAP
KSPGTTRKDNIGRSQPSPQAGLAGPGPAGYSTARPTIPPRAGVISAPQSHARASAGRLTP
ESQSKTSETSKGSTFLPEPLKPQAAFPPQSSLPPPAQRLQEPLVPVAAPMPQSGPQPNLE
TPPQPPPRSRSSHSLPSEASSQPQVKTNGISDGKRESPLKIDPFEDLSFNLLAVSKAQLS
VQTSPVPTPDPKRLIQLPSATQSNVLSSVSCMPTMPPIPARSQSQENMRSSPNPFITGLT
RTNPFSDRTAAPGNPFRAKSEESEATSWFSKEEPVTISPFPSLQPLGHNKSRASSSLDGF
KDSFDLQGQSTLKISNPKGWVTFEEEEDFGVKGKSKSACSDLLGNQPSSFSGSNLTLNDD
WNKGTNVSFCVLPSRRPPPPPVPLLPPGTSPPVDPFTTLASKASPTLDFTER
NT seq 4839 nt NT seq  +upstreamnt  +downstreamnt
atgcggaagagatgggcctgctggagcggaagtgacgctcccggcggctgtggcggcggc
tgcgggagaaggaggaggaggagccggaggaagagggctgcctccgaagaaaggagaatg
gcgttcagtaaaggattccggatctatcacaaattggatcccccacctttcagcctcata
gtggaaactaggcataaggaagaatgtctcatgttcgagtctggggctgtcgctgtgctc
tcatctgcagaaaaagaggcaatcaagggtacatactccaaagtactggatgcatatgga
ctcttaggtgttctgcggttaaatcttggtgatactatgttacattatctggtcctagtc
actggatgtatgtctgttggaaaaattcaagaatctgaagttttccgagttacttccact
gagtttatatcactgcgaatcgattcttcagatgaggatcgcatttcagaagtgcggaaa
gttttgaattcaggaaacttttattttgcatggtctgcatctggcatcagtttagatttg
agtcttaatgcgcatcgtagcatgcaagaacagacaactgataatagatttttctggaat
cagtctttgcatttgcatctcaaacactatggcgtgaattgtgatgactggttattacgt
cttatgtgtggaggagtagaaatcagaacaatttatgctgctcataaacaggcgaaggct
tgcctcatttcaagattaagctgtgaacgagctgggaccaggtttaatgtccggggaaca
aatgatgatggtcatgttgccaattttgtagaaacagaacaggttgtgtacttagatgac
tcagtttcttccttcatacaaatccgaggatctgttccattgttctgggagcaaccaggg
ttgcaagtgggatctcatcgtgtccgtatgtcaaggggatttgaagccaatgcacctgct
tttgacaggcattttagaacacttaagaacttatatggtaaacaaataatagtaaatttg
cttggatctaaggaaggtgaacatatgctaagtaaagctttccagagtcatttgaaagct
tctgaacatgctgctgatatccagatggtgaattttgactatcatcaaatggttaaggga
ggaaaggcagaaaaattacatagtgttcttaaacctcaagtccagaagtttctagattat
ggatttttttatttcaatggaagtgaagttcaaagatgccagagtggtacagttcgaaca
aactgcttggattgtcttgatagaacaaatagtgtgcaggcatttcttggcttagagatg
ctagctaaacagttggaagctcttggtttagctgaaaagcctcagttggtgactcgcttt
caagaagtttttcggtcaatgtggtccgtgaatggtgattcaatcagtaagatatatgca
ggaactggagctcttgaagggaaagcgaagttaaaagatggtgctcgctctgttacccga
acaattcagaataacttctttgacagctccaagcaagaggccattgatgttttgctactg
ggaaatactctgaatagtgatttagctgacaaagctcgagcacttttaactactggaagt
ttgcgtgtttctgagcagacattacagtcagcatcttctaaagtactaaagagcatgtgt
gagaatttctacaaatattcaaagcctaagaaaattcgagtatgtgtcggaacctggaat
gtgaatggtgggaagcaatttcgcagcatagcttttaagaatcagacactcactgactgg
cttcttgatgcacccaagttagctggcatccaggagtttcaagataaaagaagtaagcca
actgatatatttgcaattggttttgaagaaatggtagaattgaatgctggaaacattgtg
agtgcaagcacaacaaatcagaagctctgggctgtagaacttcagaagacaatctccaga
gacaacaagtatgtgctgctggcttctgaacagttggtgggcgtctgtttgtttgttttt
atcagaccacagcatgctccttttatcagggatgttgcagttgatactgtgaagactgga
atgggaggtgcaactggaaataagggagcagttgcaatccgaatgctcttccatacaacc
agcctttgcttcgtctgtagccactttgctgcagggcagtcacaagtcaaagaaagaaat
gaagattttatagaaatagcacgaaaattgagttttcctatgggaaggatgctattttcc
catgactatgtattttggtgtggtgatttcaactatcgaatcgatctccctaacgaagaa
gttaaagagctcataagacagcaaaattgggattctcttatagcaggagatcaacttatc
aatcagaaaaatgctggacaggtttttagaggatttttagaaggaaaggtaacctttgct
ccgacatataagtatgacttgttttctgacgactatgacaccagtgaaaagtgccgcacc
cctgcctggacagaccgtgtcctttggagaaggaggaaatggccttttgatagatcagct
gaagatctagatcttctaaatgctagttttcaagatgaaagcaaaattctgtacacgtgg
actccaggcactttgctgcactatggaagagctgagctgaagacttctgaccacaggcct
gtcgttgccctgattgatatagatatatttgaagttgaagctgaagagaggcaaaacatt
tataaagaagtaattgcagttcagggtccaccagatggtacagtattggtctcaatcaaa
agttctttaccagaaaataatttttttgatgatgccttgattgatgagcttctgcagcag
tttgcaagttttggtgaagttatacttataagatttgtagaagataaaatgtgggttaca
tttttggagggaagctctgccttgaatgttctgagcctaaatggtaaagagttattgaat
cggactataactattgctttaaaaagtccagactggatcaaaaatttggaagaagaaatg
agtttagagaaaattagcattgcattgccatcatcaacaagctctaccctgcttggtgaa
gatgcagaggttgcagcagattttgatatggaaggtgatgttgatgactatagtgctgaa
gtggaggaacttcttcctcagcatctccagccatcttcaagttccggccttggtacttcc
cccagctcttcaccccgaactagtccctgccagtcacctacaatatcagagggtcctgta
ccttcccttcccatcagaccaagccgagcaccgtcaagaactcctgggcctcccagtgca
cagagttctcctattgacgcgcagccagcaacgccgctgccgcagaaagaccccgcccag
cccttggagcccaagcggccgccgccgccccgcccggtcgcccctcccacacgcccggct
cccccacagagacctcctccgccttcaggggctaggagtcctgcacccactagaaaggaa
tttggaggtattggagcccctcccagtcctggggtagctaggagagagatggaagcaccc
aaaagccctggaacaacaaggaaagataatataggacgcagtcagccttcacctcaagca
ggacttgcaggcccaggacctgctggatacagtacagccagaccgacgattcctcctcgt
gctggagttatcagtgccccacagagccacgcgcgggcatctgctggaagactgactcct
gaaagccaaagcaaaacatcagaaacgtcgaaaggttcaactttccttcctgaaccactg
aagcctcaggctgcttttcctccgcagtcttctttgcccccgcctgctcaaaggttgcaa
gagcctcttgtccctgtggcagcacctatgcctcagtctggcccccagccaaatttggaa
accccaccacaaccaccacctcgaagcaggtcatcccatagcttgccttcagaagcttcc
tcacaaccgcaagtaaaaacaaatggaatctctgatggcaaaagagaatcaccattaaag
attgacccatttgaagatctgtcatttaatctgcttgctgtatcaaaggctcagctatct
gttcaaacgtcacctgttcccaccccagacccaaagaggttgattcagttgccttctgca
acgcaaagtaatgttttgagttctgtaagttgcatgccaacaatgcctccaattccagct
cggagtcaatcccaggaaaatatgcgaagttctccaaacccatttattactggcttgacc
aggacaaatcctttcagtgacaggactgctgctcctggaaacccatttagagccaagtct
gaagaatcagaggcaacttcatggttctccaaagaagagcccgttactatcagtcctttc
ccttctctgcagcctcttggtcataacaaaagcagggcttcatcttcacttgatggcttt
aaggacagttttgatctacagggccagtctacattaaaaattagcaacccgaaaggatgg
gtaaccttcgaggaagaagaggattttggtgtgaaagggaagtcaaagtcagcttgttca
gacttactgggtaatcagccaagttcattttctggctccaacctgacattgaatgatgac
tggaataaaggtacaaatgtctccttctgtgtgttgccgtcaagaagacctcctccacct
cctgtccctctgctcccgcccggcaccagccctccagtagatcctttcacgaccttggcc
tctaaggcttcacccacactggactttacagaaagataa

DBGET integrated database retrieval system