KEGG   Homo sapiens (human): 887Help
Entry
887               CDS       T01001                                 

Gene name
CCKBR, CCK-B, CCK2R, GASR
Definition
cholecystokinin B receptor
Orthology
K04195  
cholecystokinin B receptor
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Gastric acid secretion
Drug target
Proglumide: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    887 (CCKBR)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    887 (CCKBR)
 Organismal Systems
  Digestive system
   04971 Gastric acid secretion
    887 (CCKBR)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Gut peptide
   Cholecystokinin
    887 (CCKBR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11p15.4
AA seq 447 aa AA seqDB search
MELLKLNRSVQGTGPGPGASLCRPGAPLLNSSSVGNLSCEPPRIRGAGTRELELAIRITL
YAVIFLMSVGGNMLIIVVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTF
IFGTVICKAVSYLMGVSVSVSTLSLVAIALERYSAICRPLQARVWQTRSHAARVIVATWL
LSGLLMVPYPVYTVVQPVGPRVLQCVHRWPSARVRQTWSVLLLLLLFFIPGVVMAVAYGL
ISRELYLGLRFDGDSDSDSQSRVRNQGGLPGAVHQNGRCRPETGAVGEDSDGCYVQLPRS
RPALELTALTAPGPGSGSRPTQAKLLAKKRVVRMLLVIVVLFFLCWLPVYSANTWRAFDG
PGAHRALSGAPISFIHLLSYASACVNPLVYCFMHRRFRQACLETCARCCPRPPRARPRAL
PDEDPPTPSIASLSRLSYTTISTLGPG
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggagctgctaaagctgaaccggagcgtgcagggaaccggacccgggccgggggcttcc
ctgtgccgcccgggggcgcctctcctcaacagcagcagtgtgggcaacctcagctgcgag
ccccctcgcattcgcggagccgggacacgagaattggagctggccattagaatcactctt
tacgcagtgatcttcctgatgagcgttggaggaaatatgctcatcatcgtggtcctggga
ctgagccgccgcctgaggactgtcaccaatgccttcctcctctcactggcagtcagcgac
ctcctgctggctgtggcttgcatgcccttcaccctcctgcccaatctcatgggcacattc
atctttggcaccgtcatctgcaaggcggtttcctacctcatgggggtgtctgtgagtgtg
tccacgctaagcctcgtggccatcgcactggagcggtacagcgccatctgccgaccactg
caggcacgagtgtggcagacgcgctcccacgcggctcgcgtgattgtagccacgtggctg
ctgtccggactactcatggtgccctaccccgtgtacactgtcgtgcaaccagtggggcct
cgtgtgctgcagtgcgtgcatcgctggcccagtgcgcgggtccgccagacctggtccgta
ctgctgcttctgctcttgttcttcatcccgggtgtggttatggccgtggcctacgggctt
atctctcgcgagctctacttagggcttcgctttgacggcgacagtgacagcgacagccaa
agcagggtccgaaaccaaggcgggctgccaggggctgttcaccagaacgggcgttgccgg
cctgagactggcgcggttggcgaagacagcgatggctgctacgtgcaacttccacgttcc
cggcctgccctggagctgacggcgctgacggctcctgggccgggatccggctcccggccc
acccaggccaagctgctggctaagaagcgcgtggtgcgaatgttgctggtgatcgttgtg
cttttttttctgtgttggttgccagtttatagtgccaacacgtggcgcgcctttgatggc
ccgggtgcacaccgagcactctcgggtgctcctatctccttcattcacttgctgagctac
gcctcggcctgtgtcaaccccctggtctactgcttcatgcaccgtcgctttcgccaggcc
tgcctggaaacttgcgctcgctgctgcccccggcctccacgagctcgccccagggctctt
cccgatgaggaccctcccactccctccattgcttcgctgtccaggcttagctacaccacc
atcagcacactgggccctggctga

DBGET integrated database retrieval system