KEGG   Homo sapiens (human): 8876Help
Entry
8876              CDS       T01001                                 

Gene name
VNN1, HDLCQ8, Tiff66
Definition
vanin 1 (EC:3.5.1.92)
Orthology
K08069  
pantetheine hydrolase [EC:3.5.1.92]
Organism
hsa  Homo sapiens (human)
Pathway
Pantothenate and CoA biosynthesis
Class
Metabolism; Metabolism of cofactors and vitamins; Pantothenate and CoA biosynthesis [PATH:hsa00770]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6q23-q24
AA seq 513 aa AA seqDB search
MTTQLPAYVAILLFYVSRASCQDTFTAAVYEHAAILPNATLTPVSREEALALMNRNLDIL
EGAITSAADQGAHIIVTPEDAIYGWNFNRDSLYPYLEDIPDPEVNWIPCNNRNRFGQTPV
QERLSCLAKNNSIYVVANIGDKKPCDTSDPQCPPDGRYQYNTDVVFDSQGKLVARYHKQN
LFMGENQFNVPKEPEIVTFNTTFGSFGIFTCFDILFHDPAVTLVKDFHVDTIVFPTAWMN
VLPHLSAVEFHSAWAMGMRVNFLASNIHYPSKKMTGSGIYAPNSSRAFHYDMKTEEGKLL
LSQLDSHPSHSAVVNWTSYASSIEALSSGNKEFKGTVFFDEFTFVKLTGVAGNYTVCQKD
LCCHLSYKMSENIPNEVYALGAFDGLHTVEGRYYLQICTLLKCKTTNLNTCGDSAETAST
RFEMFSLSGTFGTQYVFPEVLLSENQLAPGEFQVSTDGRLFSLKPTSGPVLTVTLFGRLY
EKDWASNASSGLTAQARIIMLIVIAPIVCSLSW
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgactactcagttgccagcttacgtggcaattttgcttttctatgtctcaagagccagc
tgccaggacactttcactgcagctgtttatgagcatgcagcgatattgcccaatgccacc
ctaacaccagtgtctcgtgaggaggctttggcattaatgaatcggaatctggacattttg
gaaggagcgatcacatcagcagcagatcagggtgcgcatattattgtgactccagaagat
gctatttatggctggaacttcaacagggactctctctacccatatttggaggacatccca
gaccctgaagtaaactggatcccctgtaataatcgtaacagatttggccagaccccagta
caagaaagactcagctgcctggccaagaacaactctatctatgttgtggcaaatattggg
gacaagaagccatgcgataccagtgatcctcagtgtccccctgatggccgttaccaatac
aacactgatgtggtatttgattctcaaggaaaactggtggcacgctaccataagcaaaac
cttttcatgggtgaaaatcaattcaatgtacccaaggagcctgagattgtgactttcaat
accacctttggaagttttggcattttcacatgctttgatatactcttccatgatcctgct
gttaccttggtgaaagatttccacgtggacaccatagtattcccaacagcttggatgaat
gttttgccacatttgtcagctgttgaattccactcagcttgggctatgggcatgagggtc
aatttccttgcatccaacatacattacccctcaaagaaaatgacaggaagtggcatctat
gcacccaattcttcaagagcatttcattatgatatgaagacagaagagggaaaactcctc
ctctcgcaactggattcccacccatcccattctgcagtggtgaactggacttcctatgcc
agcagtatagaagcgctctcatcaggaaacaaggaatttaaaggcactgtctttttcgat
gaattcacttttgtgaagctcacaggagttgcaggaaattatacagtttgtcagaaagat
ctctgctgtcatttaagctacaaaatgtctgagaacataccaaatgaagtgtacgctcta
ggggcatttgacggactgcacactgtggaagggcgctattatctacagatttgtaccctg
ttgaaatgtaaaacgactaatttaaacacttgcggtgactcagctgaaacagcttctacc
aggtttgaaatgttctccctcagtggcactttcggaacccagtatgtctttcctgaggtg
ttgctgagtgaaaatcagcttgcacctggagaatttcaggtgtcaactgacggacgcttg
tttagtctgaagccaacatccggacctgtcttaacagtaactctgtttgggaggttgtat
gagaaggactgggcatcaaatgcttcatcaggcctcacagcacaagcaagaataataatg
ctaatagttatagcacctattgtatgctcattaagttggtag

DBGET integrated database retrieval system