KEGG   Homo sapiens (human): 8877Help
Entry
8877              CDS       T01001                                 

Gene name
SPHK1, SPHK
Definition
sphingosine kinase 1 (EC:2.7.1.91)
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
hsa  Homo sapiens (human)
Pathway
Sphingolipid metabolism
Metabolic pathways
Calcium signaling pathway
VEGF signaling pathway
Fc gamma R-mediated phagocytosis
Tuberculosis
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    8877 (SPHK1)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    8877 (SPHK1)
   04020 Calcium signaling pathway
    8877 (SPHK1)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    8877 (SPHK1)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    8877 (SPHK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     8877 (SPHK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q25.2
AA seq 384 aa AA seqDB search
MDPAGGPRGVLPRPCRVLVLLNPRGGKGKALQLFRSHVQPLLAEAEISFTLMLTERRNHA
RELVRSEELGRWDALVVMSGDGLMHEVVNGLMERPDWETAIQKPLCSLPAGSGNALAASL
NHYAGYEQVTNEDLLTNCTLLLCRRLLSPMNLLSLHTASGLRLFSVLSLAWGFIADVDLE
SEKYRRLGEMRFTLGTFLRLAALRTYRGRLAYLPVGRVGSKTPASPVVVQQGPVDAHLVP
LEEPVPSHWTVVPDEDFVLVLALLHSHLGSEMFAAPMGRCAAGVMHLFYVRAGVSRAMLL
RLFLAMEKGRHMEYECPYLVYVPVVAFRLEPKDGKGVFAVDGELMVSEAVQGQVHPNYFW
MVSGCVEPPPSWKPQQMPPPEEPL
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggatccagcgggcggcccccggggcgtgctcccgcggccctgccgcgtgctggtgctg
ctgaacccgcgcggcggcaagggcaaggccttgcagctcttccggagtcacgtgcagccc
cttttggctgaggctgaaatctccttcacgctgatgctcactgagcggcggaaccacgcg
cgggagctggtgcggtcggaggagctgggccgctgggacgctctggtggtcatgtctgga
gacgggctgatgcacgaggtggtgaacgggctcatggagcggcctgactgggagaccgcc
atccagaagcccctgtgtagcctcccagcaggctctggcaacgcgctggcagcttccttg
aaccattatgctggctatgagcaggtcaccaatgaagacctcctgaccaactgcacgcta
ttgctgtgccgccggctgctgtcacccatgaacctgctgtctctgcacacggcttcgggg
ctgcgcctcttctctgtgctcagcctggcctggggcttcattgctgatgtggacctagag
agtgagaagtatcggcgtctgggggagatgcgcttcactctgggcaccttcctgcgtctg
gcagccctgcgcacctaccgcggccgactggcctacctccctgtaggaagagtgggttcc
aagacacctgcctcccccgttgtggtccagcagggcccggtagatgcacaccttgtgcca
ctggaggagccagtgccctctcactggacagtggtgcccgacgaggactttgtgctagtc
ctggcactgctgcactcgcacctgggcagtgagatgtttgctgcacccatgggccgctgt
gcagctggcgtcatgcatctgttctacgtgcgggcgggagtgtctcgtgccatgctgctg
cgcctcttcctggccatggagaagggcaggcatatggagtatgaatgcccctacttggta
tatgtgcccgtggtcgccttccgcttggagcccaaggatgggaaaggtgtgtttgcagtg
gatggggaattgatggttagcgaggccgtgcagggccaggtgcacccaaactacttctgg
atggtcagcggttgcgtggagcccccgcccagctggaagccccagcagatgccaccgcca
gaagagcccttatga

DBGET integrated database retrieval system