KEGG   Homo sapiens (human): 8877Help
Entry
8877              CDS       T01001                                 

Gene name
SPHK1, SPHK
Definition
(RefSeq) sphingosine kinase 1 (EC:2.7.1.91)
  KO
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
hsa  Homo sapiens (human)
Pathway
Sphingolipid metabolism
Metabolic pathways
Calcium signaling pathway
Sphingolipid signaling pathway
Phospholipase D signaling pathway
VEGF signaling pathway
Fc gamma R-mediated phagocytosis
Tuberculosis
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    8877 (SPHK1)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    8877 (SPHK1)
   04020 Calcium signaling pathway
    8877 (SPHK1)
   04072 Phospholipase D signaling pathway
    8877 (SPHK1)
   04071 Sphingolipid signaling pathway
    8877 (SPHK1)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    8877 (SPHK1)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    8877 (SPHK1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     8877 (SPHK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q25.2
AA seq 384 aa AA seqDB search
MDPAGGPRGVLPRPCRVLVLLNPRGGKGKALQLFRSHVQPLLAEAEISFTLMLTERRNHA
RELVRSEELGRWDALVVMSGDGLMHEVVNGLMERPDWETAIQKPLCSLPAGSGNALAASL
NHYAGYEQVTNEDLLTNCTLLLCRRLLSPMNLLSLHTASGLRLFSVLSLAWGFIADVDLE
SEKYRRLGEMRFTLGTFLRLAALRTYRGRLAYLPVGRVGSKTPASPVVVQQGPVDAHLVP
LEEPVPSHWTVVPDEDFVLVLALLHSHLGSEMFAAPMGRCAAGVMHLFYVRAGVSRAMLL
RLFLAMEKGRHMEYECPYLVYVPVVAFRLEPKDGKGVFAVDGELMVSEAVQGQVHPNYFW
MVSGCVEPPPSWKPQQMPPPEEPL
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggatccagcgggcggcccccggggcgtgctcccgcggccctgccgcgtgctggtgctg
ctgaacccgcgcggcggcaagggcaaggccttgcagctcttccggagtcacgtgcagccc
cttttggctgaggctgaaatctccttcacgctgatgctcactgagcggcggaaccacgcg
cgggagctggtgcggtcggaggagctgggccgctgggacgctctggtggtcatgtctgga
gacgggctgatgcacgaggtggtgaacgggctcatggagcggcctgactgggagaccgcc
atccagaagcccctgtgtagcctcccagcaggctctggcaacgcgctggcagcttccttg
aaccattatgctggctatgagcaggtcaccaatgaagacctcctgaccaactgcacgcta
ttgctgtgccgccggctgctgtcacccatgaacctgctgtctctgcacacggcttcgggg
ctgcgcctcttctctgtgctcagcctggcctggggcttcattgctgatgtggacctagag
agtgagaagtatcggcgtctgggggagatgcgcttcactctgggcaccttcctgcgtctg
gcagccctgcgcacctaccgcggccgactggcctacctccctgtaggaagagtgggttcc
aagacacctgcctcccccgttgtggtccagcagggcccggtagatgcacaccttgtgcca
ctggaggagccagtgccctctcactggacagtggtgcccgacgaggactttgtgctagtc
ctggcactgctgcactcgcacctgggcagtgagatgtttgctgcacccatgggccgctgt
gcagctggcgtcatgcatctgttctacgtgcgggcgggagtgtctcgtgccatgctgctg
cgcctcttcctggccatggagaagggcaggcatatggagtatgaatgcccctacttggta
tatgtgcccgtggtcgccttccgcttggagcccaaggatgggaaaggtgtgtttgcagtg
gatggggaattgatggttagcgaggccgtgcagggccaggtgcacccaaactacttctgg
atggtcagcggttgcgtggagcccccgcccagctggaagccccagcagatgccaccgcca
gaagagcccttatga

DBGET integrated database retrieval system