KEGG   Homo sapiens (human): 8878Help
Entry
8878              CDS       T01001                                 

Gene name
SQSTM1, A170, FTDALS3, OSIL, PDB3, ZIP3, p60, p62, p62B
Definition
(RefSeq) sequestosome 1
  KO
K14381  
sequestosome 1
Organism
hsa  Homo sapiens (human)
Pathway
Osteoclast differentiation
Disease
H00437  
Paget's disease of bone and related disorders
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Development
   04380 Osteoclast differentiation
    8878 (SQSTM1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-dependent mechanism factors
    8878 (SQSTM1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   8878 (SQSTM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q35
AA seq 440 aa AA seqDB search
MASLTVKAYLLGKEDAAREIRRFSFCCSPEPEAEAEAAAGPGPCERLLSRVAALFPALRP
GGFQAHYRDEDGDLVAFSSDEELTMAMSYVKDDIFRIYIKEKKECRRDHRPPCAQEAPRN
MVHPNVICDGCNGPVVGTRYKCSVCPDYDLCSVCEGKGLHRGHTKLAFPSPFGHLSEGFS
HSRWLRKVKHGHFGWPGWEMGPPGNWSPRPPRAGEARPGPTAESASGPSEDPSVNFLKNV
GESVAAALSPLGIEVDIDVEHGGKRSRLTPVSPESSSTEEKSSSQPSSCCSDPSKPGGNV
EGATQSLAEQMRKIALESEGRPEEQMESDNCSGGDDDWTHLSSKEVDPSTGELQSLQMPE
SEGPSSLDPSQEGPTGLKEAALYPHLPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTK
NYDIGAALDTIQYSKHPPPL
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgctcaccgtgaaggcctaccttctgggcaaggaggacgcggcgcgcgagatt
cgccgcttcagcttctgctgcagccccgagcctgaggcggaagccgaggctgcggcgggt
ccgggaccctgcgagcggctgctgagccgggtggccgccctgttccccgcgctgcggcct
ggcggcttccaggcgcactaccgcgatgaggacggggacttggttgccttttccagtgac
gaggaattgacaatggccatgtcctacgtgaaggatgacatcttccgaatctacattaaa
gagaaaaaagagtgccggcgggaccaccgcccaccgtgtgctcaggaggcgccccgcaac
atggtgcaccccaatgtgatctgcgatggctgcaatgggcctgtggtaggaacccgctac
aagtgcagcgtctgcccagactacgacttgtgtagcgtctgcgagggaaagggcttgcac
cgggggcacaccaagctcgcattccccagccccttcgggcacctgtctgagggcttctcg
cacagccgctggctccggaaggtgaaacacggacacttcgggtggccaggatgggaaatg
ggtccaccaggaaactggagcccacgtcctcctcgtgcaggggaggcccgccctggcccc
acggcagaatcagcttctggtccatcggaggatccgagtgtgaatttcctgaagaacgtt
ggggagagtgtggcagctgcccttagccctctgggcattgaagttgatatcgatgtggag
cacggagggaaaagaagccgcctgacccccgtctctccagagagttccagcacagaggag
aagagcagctcacagccaagcagctgctgctctgaccccagcaagccgggtgggaatgtt
gagggcgccacgcagtctctggcggagcagatgaggaagatcgccttggagtccgagggg
cgccctgaggaacagatggagtcggataactgttcaggaggagatgatgactggacccat
ctgtcttcaaaagaagtggacccgtctacaggtgaactccagtccctacagatgccagaa
tccgaagggccaagctctctggacccctcccaggagggacccacagggctgaaggaagct
gccttgtacccacatctcccgccagaggctgacccgcggctgattgagtccctctcccag
atgctgtccatgggcttctctgatgaaggcggctggctcaccaggctcctgcagaccaag
aactatgacatcggagcggctctggacaccatccagtattcaaagcatcccccgccgttg
tga

DBGET integrated database retrieval system