KEGG   Homo sapiens (human): 8878Help
Entry
8878              CDS       T01001                                 

Gene name
SQSTM1, A170, DMRV, FTDALS3, NADGP, OSIL, PDB3, ZIP3, p60, p62, p62B
Definition
(RefSeq) sequestosome 1
  KO
K14381  
sequestosome 1
Organism
hsa  Homo sapiens (human)
Pathway
Mitophagy - animal
Necroptosis
Cellular senescence
Osteoclast differentiation
Fluid shear stress and atherosclerosis
Disease
H00437  
Paget's disease of bone and related disorders
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04137 Mitophagy - animal
    8878 (SQSTM1)
  Cell growth and death
   04217 Necroptosis
    8878 (SQSTM1)
   04218 Cellular senescence
    8878 (SQSTM1)
 Organismal Systems
  Development
   04380 Osteoclast differentiation
    8878 (SQSTM1)
 Human Diseases
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    8878 (SQSTM1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-dependent mechanism factors
    8878 (SQSTM1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   8878 (SQSTM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q13501(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
5q35.3
AA seq 440 aa AA seqDB search
MASLTVKAYLLGKEDAAREIRRFSFCCSPEPEAEAEAAAGPGPCERLLSRVAALFPALRP
GGFQAHYRDEDGDLVAFSSDEELTMAMSYVKDDIFRIYIKEKKECRRDHRPPCAQEAPRN
MVHPNVICDGCNGPVVGTRYKCSVCPDYDLCSVCEGKGLHRGHTKLAFPSPFGHLSEGFS
HSRWLRKVKHGHFGWPGWEMGPPGNWSPRPPRAGEARPGPTAESASGPSEDPSVNFLKNV
GESVAAALSPLGIEVDIDVEHGGKRSRLTPVSPESSSTEEKSSSQPSSCCSDPSKPGGNV
EGATQSLAEQMRKIALESEGRPEEQMESDNCSGGDDDWTHLSSKEVDPSTGELQSLQMPE
SEGPSSLDPSQEGPTGLKEAALYPHLPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTK
NYDIGAALDTIQYSKHPPPL
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgctcaccgtgaaggcctaccttctgggcaaggaggacgcggcgcgcgagatt
cgccgcttcagcttctgctgcagccccgagcctgaggcggaagccgaggctgcggcgggt
ccgggaccctgcgagcggctgctgagccgggtggccgccctgttccccgcgctgcggcct
ggcggcttccaggcgcactaccgcgatgaggacggggacttggttgccttttccagtgac
gaggaattgacaatggccatgtcctacgtgaaggatgacatcttccgaatctacattaaa
gagaaaaaagagtgccggcgggaccaccgcccaccgtgtgctcaggaggcgccccgcaac
atggtgcaccccaatgtgatctgcgatggctgcaatgggcctgtggtaggaacccgctac
aagtgcagcgtctgcccagactacgacttgtgtagcgtctgcgagggaaagggcttgcac
cgggggcacaccaagctcgcattccccagccccttcgggcacctgtctgagggcttctcg
cacagccgctggctccggaaggtgaaacacggacacttcgggtggccaggatgggaaatg
ggtccaccaggaaactggagcccacgtcctcctcgtgcaggggaggcccgccctggcccc
acggcagaatcagcttctggtccatcggaggatccgagtgtgaatttcctgaagaacgtt
ggggagagtgtggcagctgcccttagccctctgggcattgaagttgatatcgatgtggag
cacggagggaaaagaagccgcctgacccccgtctctccagagagttccagcacagaggag
aagagcagctcacagccaagcagctgctgctctgaccccagcaagccgggtgggaatgtt
gagggcgccacgcagtctctggcggagcagatgaggaagatcgccttggagtccgagggg
cgccctgaggaacagatggagtcggataactgttcaggaggagatgatgactggacccat
ctgtcttcaaaagaagtggacccgtctacaggtgaactccagtccctacagatgccagaa
tccgaagggccaagctctctggacccctcccaggagggacccacagggctgaaggaagct
gccttgtacccacatctcccgccagaggctgacccgcggctgattgagtccctctcccag
atgctgtccatgggcttctctgatgaaggcggctggctcaccaggctcctgcagaccaag
aactatgacatcggagcggctctggacaccatccagtattcaaagcatcccccgccgttg
tga

DBGET integrated database retrieval system