KEGG   Homo sapiens (human): 8879Help
Entry
8879              CDS       T01001                                 

Gene name
SGPL1, S1PL, SPL
Definition
sphingosine-1-phosphate lyase 1 (EC:4.1.2.27)
Orthology
K01634  
sphinganine-1-phosphate aldolase [EC:4.1.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    8879 (SGPL1)
Enzymes [BR:hsa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.27  sphinganine-1-phosphate aldolase
     8879 (SGPL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
10q21
AA seq 568 aa AA seqDB search
MPSTDLLMLKAFEPYLEILEVYSTKAKNYVNGHCTKYEPWQLIAWSVVWTLLIVWGYEFV
FQPESLWSRFKKKCFKLTRKMPIIGRKIQDKLNKTKDDISKNMSFLKVDKEYVKALPSQG
LSSSAVLEKLKEYSSMDAFWQEGRASGTVYSGEEKLTELLVKAYGDFAWSNPLHPDIFPG
LRKIEAEIVRIACSLFNGGPDSCGCVTSGGTESILMACKAYRDLAFEKGIKTPEIVAPQS
AHAAFNKAASYFGMKIVRVPLTKMMEVDVRAMRRAISRNTAMLVCSTPQFPHGVIDPVPE
VAKLAVKYKIPLHVDACLGGFLIVFMEKAGYPLEHPFDFRVKGVTSISADTHKYGYAPKG
SSLVLYSDKKYRNYQFFVDTDWQGGIYASPTIAGSRPGGISAACWAALMHFGENGYVEAT
KQIIKTARFLKSELENIKGIFVFGNPQLSVIALGSRDFDIYRLSNLMTAKGWNLNQLQFP
PSIHFCITLLHARKRVAIQFLKDIRESVTQIMKNPKAKTTGMGAIYGMAQTTVDRNMVAE
LSSVFLDSLYSTDTVTQGSQMNGSPKPH
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgcctagcacagaccttctgatgttgaaggcctttgagccctacttagagattttggaa
gtatactccacaaaagccaagaattatgtaaatggacattgcaccaagtatgagccctgg
cagctaattgcatggagtgtcgtgtggaccctgctgatagtctggggatatgagtttgtc
ttccagccagagagtttatggtcaaggtttaaaaagaaatgttttaagctcaccaggaag
atgcccattattggtcgtaagattcaagacaagttgaacaagaccaaggatgatattagc
aagaacatgtcattcctgaaagtggacaaagagtatgtgaaagctttaccctcccagggt
ctgagctcatctgctgttttggagaaacttaaggagtacagctctatggacgccttctgg
caagaggggagagcctctggaacagtgtacagtggggaggagaagctcactgagctcctt
gtgaaggcttatggagattttgcatggagtaaccccctgcatccagatatcttcccagga
ctacgcaagatagaggcagaaatcgtgaggatagcttgttccctgttcaatgggggacca
gattcgtgtggatgtgtgacttctgggggaacagaaagcatactgatggcctgcaaagca
tatcgggatctggcctttgagaaggggatcaaaactccagaaattgtggctccccaaagt
gcccatgctgcatttaacaaagcagccagttactttgggatgaagattgtgcgggtccca
ttgacgaagatgatggaggtggatgtgcgggcaatgagaagagctatctccaggaacact
gccatgctcgtctgttctaccccacagtttcctcatggtgtaatagatcctgtccctgaa
gtggccaagctggctgtcaaatacaaaataccccttcatgtcgacgcttgtctgggaggc
ttcctcatcgtctttatggagaaagcaggatacccactggagcacccatttgatttccgg
gtgaaaggtgtaaccagcatttcagctgacacccataagtatggctatgccccaaaaggc
tcatcattggtgttgtatagtgacaagaagtacaggaactatcagttcttcgtcgataca
gattggcagggtggcatctatgcttccccaaccatcgcaggctcacggcctggtggcatt
agcgcagcctgttgggctgccttgatgcacttcggtgagaacggctatgttgaagctacc
aaacagatcatcaaaactgctcgcttcctcaagtcagaactggaaaatatcaaaggcatc
tttgtttttgggaatccccaattgtcagtcattgctctgggatcccgtgattttgacatc
taccgactatcaaacctgatgactgctaaggggtggaacttgaaccagttgcagttccca
cccagtattcatttctgcatcacattactacacgcccggaaacgagtagctatacaattc
ctaaaggacattcgagaatctgtcactcaaatcatgaagaatcctaaagcgaagaccaca
ggaatgggtgccatctatggcatggcccagacaactgttgacaggaatatggttgcagaa
ttgtcctcagtcttcttggacagcttgtacagcaccgacactgtcacccagggcagccag
atgaatggttctccaaaaccccactga

DBGET integrated database retrieval system