KEGG   Homo sapiens (human): 8881Help
Entry
8881              CDS       T01001                                 

Gene name
CDC16, ANAPC6, APC6, CUT9
Definition
cell division cycle 16
Orthology
K03353  
anaphase-promoting complex subunit 6
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
HTLV-I infection
Module
APC/C complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    8881 (CDC16)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    8881 (CDC16)
   04114 Oocyte meiosis
    8881 (CDC16)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    8881 (CDC16)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    8881 (CDC16)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     8881 (CDC16)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     8881 (CDC16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
13q34
AA seq 620 aa AA seqDB search
MNLERLRKRVRQYLDQQQYQSALFWADKVASLSREEPQDIYWLAQCLYLTAQYHRAAHAL
RSRKLDKLYEACRYLAARCHYAAKEHQQALDVLDMEEPINKRLFEKYLKDESGFKDPSSD
WEMSQSSIKSSICLLRGKIYDALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQE
EKELLESLPLSKLCNEEQELLRFLFENKLKKYNKPSETVIPESVDGLQENLDVVVSLAER
HYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPV
SWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTA
AQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKT
AEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNAS
TYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAYIGADIKD
KLKCYDFDVHTMKTLKNIISPPWDFREFEVEKQTAEETGLTPLETSRKTPDSRPSLEETF
EIEMNESDMMLETSMSDHST
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgaacctagagcggctgcggaagcgcgtccggcagtacctcgaccagcaacagtatcaa
agtgctctattttgggcagataaagtagcttcactctctcgtgaagaaccccaggacatc
tattggttggctcagtgtctttacctgacagcacaatatcacagagccgcccatgcactt
cggtcacgaaaactggacaaattgtatgaagcatgtcgttaccttgcagctaggtgccat
tatgctgcaaaagagcaccagcaggcccttgatgttcttgacatggaagagcccatcaat
aaaagattatttgaaaaatacttgaaggacgaaagtggcttcaaagatccttccagcgac
tgggaaatgtcacagtcttcaataaagagttctatctgtcttctacgcgggaaaatctat
gatgctctagataaccgaaccctggctacctacagctacaaagaagctttgaagcttgat
gtctactgttttgaagcgttcgatcttttaacatcacatcacatgctgacagcacaagaa
gaaaaagaacttcttgaatcactaccccttagcaagctgtgtaatgaagaacaggaattg
ctgcgttttctatttgagaacaaattgaaaaaatataataagcctagtgaaacggtcatc
cctgaatctgtagatggcttgcaagagaatctggatgtggtagtgtctttagctgagaga
cattattataactgtgattttaaaatgtgctacaagcttacttctgtagtaatggagaaa
gatcctttccatgcaagttgtttacctgtacatatagggacgcttgtagagctgaataaa
gccaatgaacttttctatctttctcataaactggtggatttatatcctagtaatcctgtg
tcttggtttgcagtgggatgttactatctcatggtcggtcataaaaatgaacatgccaga
agatatctcagcaaagccacaacacttgagaaaacctatggacctgcatggatagcctat
ggacattcatttgcggtggagagtgagcacgaccaagcgatggctgcttacttcacagca
gcacagctgatgaaagggtgtcatttgcctatgctgtatattggattagaatatggtttg
accaataactcaaaactagctgaaaggttcttcagccaagctctgagcattgcaccggaa
gacccttttgttatgcatgaggtcggcgtggttgcatttcagaatggagaatggaaaaca
gccgaaaaatggtttcttgatgctttggaaaaaattaaagcaattgggaacgaggtaaca
gttgacaaatgggaacctttgttgaacaacttggggcatgtctgcagaaaacttaaaaag
tatgctgaggccttggattaccaccgtcaggcactggtgttgattcctcagaacgcatcc
acctactctgctattggatatatccacagtctgatgggcaactttgaaaatgctgtggac
tacttccacacagcccttggtcttaggcgagatgatacattttctgttacaatgcttggt
cattgcatcgaaatgtacattggtgattctgaagcttatattggagcagacattaaagac
aaattaaaatgttatgactttgatgtgcatacaatgaagacactaaaaaacattatttca
cctccgtgggatttcagggaatttgaagtagaaaaacagactgcagaagaaacggggctt
acgccattggaaacctcaaggaaaactccagattccagaccttccttggaagaaaccttt
gaaattgaaatgaatgaaagtgacatgatgttagagacatctatgtcagaccacagcacg
tga

DBGET integrated database retrieval system