KEGG   Homo sapiens (human): 8881Help
Entry
8881              CDS       T01001                                 

Gene name
CDC16, ANAPC6, APC6, CUT9
Definition
cell division cycle 16
Orthology
K03353  
anaphase-promoting complex subunit 6
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
HTLV-I infection
Module
APC/C complex
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:hsa04120]
Cellular Processes; Cell growth and death; Cell cycle [PATH:hsa04110]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:hsa04114]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:hsa04914]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:hsa05166]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
13q34
AA seq 620 aa AA seqDB search
MNLERLRKRVRQYLDQQQYQSALFWADKVASLSREEPQDIYWLAQCLYLTAQYHRAAHAL
RSRKLDKLYEACRYLAARCHYAAKEHQQALDVLDMEEPINKRLFEKYLKDESGFKDPSSD
WEMSQSSIKSSICLLRGKIYDALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQE
EKELLESLPLSKLCNEEQELLRFLFENKLKKYNKPSETVIPESVDGLQENLDVVVSLAER
HYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPV
SWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTA
AQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKT
AEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNAS
TYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAYIGADIKD
KLKCYDFDVHTMKTLKNIISPPWDFREFEVEKQTAEETGLTPLETSRKTPDSRPSLEETF
EIEMNESDMMLETSMSDHST
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgaacctagagcggctgcggaagcgcgtccggcagtacctcgaccagcaacagtatcaa
agtgctctattttgggcagataaagtagcttcactctctcgtgaagaaccccaggacatc
tattggttggctcagtgtctttacctgacagcacaatatcacagagccgcccatgcactt
cggtcacgaaaactggacaaattgtatgaagcatgtcgttaccttgcagctaggtgccat
tatgctgcaaaagagcaccagcaggcccttgatgttcttgacatggaagagcccatcaat
aaaagattatttgaaaaatacttgaaggacgaaagtggcttcaaagatccttccagcgac
tgggaaatgtcacagtcttcaataaagagttctatctgtcttctacgcgggaaaatctat
gatgctctagataaccgaaccctggctacctacagctacaaagaagctttgaagcttgat
gtctactgttttgaagcgttcgatcttttaacatcacatcacatgctgacagcacaagaa
gaaaaagaacttcttgaatcactaccccttagcaagctgtgtaatgaagaacaggaattg
ctgcgttttctatttgagaacaaattgaaaaaatataataagcctagtgaaacggtcatc
cctgaatctgtagatggcttgcaagagaatctggatgtggtagtgtctttagctgagaga
cattattataactgtgattttaaaatgtgctacaagcttacttctgtagtaatggagaaa
gatcctttccatgcaagttgtttacctgtacatatagggacgcttgtagagctgaataaa
gccaatgaacttttctatctttctcataaactggtggatttatatcctagtaatcctgtg
tcttggtttgcagtgggatgttactatctcatggtcggtcataaaaatgaacatgccaga
agatatctcagcaaagccacaacacttgagaaaacctatggacctgcatggatagcctat
ggacattcatttgcggtggagagtgagcacgaccaagcgatggctgcttacttcacagca
gcacagctgatgaaagggtgtcatttgcctatgctgtatattggattagaatatggtttg
accaataactcaaaactagctgaaaggttcttcagccaagctctgagcattgcaccggaa
gacccttttgttatgcatgaggtcggcgtggttgcatttcagaatggagaatggaaaaca
gccgaaaaatggtttcttgatgctttggaaaaaattaaagcaattgggaacgaggtaaca
gttgacaaatgggaacctttgttgaacaacttggggcatgtctgcagaaaacttaaaaag
tatgctgaggccttggattaccaccgtcaggcactggtgttgattcctcagaacgcatcc
acctactctgctattggatatatccacagtctgatgggcaactttgaaaatgctgtggac
tacttccacacagcccttggtcttaggcgagatgatacattttctgttacaatgcttggt
cattgcatcgaaatgtacattggtgattctgaagcttatattggagcagacattaaagac
aaattaaaatgttatgactttgatgtgcatacaatgaagacactaaaaaacattatttca
cctccgtgggatttcagggaatttgaagtagaaaaacagactgcagaagaaacggggctt
acgccattggaaacctcaaggaaaactccagattccagaccttccttggaagaaaccttt
gaaattgaaatgaatgaaagtgacatgatgttagagacatctatgtcagaccacagcacg
tga

DBGET integrated database retrieval system