KEGG   Homo sapiens (human): 8884Help
Entry
8884              CDS       T01001                                 

Gene name
SLC5A6, SMVT
Definition
solute carrier family 5 (sodium/multivitamin and iodide cotransporter), member 6
Orthology
K14386  
solute carrier family 5 (sodium-dependent multivitamin transporter), member 6
Organism
hsa  Homo sapiens (human)
Pathway
Vitamin digestion and absorption
Class
Organismal Systems; Digestive system; Vitamin digestion and absorption [PATH:hsa04977]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2p23
AA seq 635 aa AA seqDB search
MSVGVSTSAPLSPTSGTSVGMSTFSIMDYVVFVLLLVLSLAIGLYHACRGWGRHTVGELL
MADRKMGCLPVALSLLATFQSAVAILGVPSEIYRFGTQYWFLGCCYFLGLLIPAHIFIPV
FYRLHLTSAYEYLELRFNKTVRVCGTVTFIFQMVIYMGVVLYAPSLALNAVTGFDLWLSV
LALGIVCTVYTALGGLKAVIWTDVFQTLVMFLGQLAVIIVGSAKVGGLGRVWAVASQHGR
ISGFELDPDPFVRHTFWTLAFGGVFMMLSLYGVNQAQVQRYLSSRTEKAAVLSCYAVFPF
QQVSLCVGCLIGLVMFAYYQEYPMSIQQAQAAPDQFVLYFVMDLLKGLPGLPGLFIACLF
SGSLSTISSAFNSLATVTMEDLIRPWFPEFSEARAIMLSRGLAFGYGLLCLGMAYISSQM
GPVLQAAISIFGMVGGPLLGLFCLGMFFPCANPPGAVVGLLAGLVMAFWIGIGSIVTSMG
SSMPPSPSNGSSFSLPTNLTVATVTTLMPLTTFSKPTGLQRFYSLSYLWYSAHNSTTVIV
VGLIVSLLTGRMRGRSLNPATIYPVLPKLLSLLPLSCQKRLHCRSYGQDHLDTGLFPEKP
RNGVLGDSRDKEAMALDGTAYQGSSSTCILQETSL
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtaggggtgagcacctcagcccctctttccccaacctcgggcacaagcgtgggc
atgtctaccttctccatcatggactatgtggtgttcgtcctgctgctggttctctctctt
gccattgggctctaccatgcttgtcgtggctggggccggcatactgttggtgagctgctg
atggcggaccgcaaaatgggctgccttccggtggcactgtccctgctggccaccttccag
tcagccgtggccatcctgggtgtgccgtcagagatctaccgatttgggacccaatattgg
ttcctgggctgctgctactttctggggctgctgatacctgcacacatcttcatccccgtt
ttctaccgcctgcatctcaccagtgcctatgagtacctggagcttcgattcaataaaact
gtgcgagtgtgtggaactgtgaccttcatctttcagatggtgatctacatgggagttgtg
ctctatgctccgtcattggctctcaatgcagtgactggctttgatctgtggctgtccgtg
ctggccctgggcattgtctgtaccgtctatacagctctgggtgggctgaaggccgtcatc
tggacagatgtgttccagacactggtcatgttcctcgggcagctggcagttatcatcgtg
gggtcagccaaggtgggcggcttggggcgtgtgtgggccgtggcttcccagcacggccgc
atctctgggtttgagctggatccagacccctttgtgcggcacaccttctggaccttggcc
ttcgggggtgtcttcatgatgctctccttatacggggtgaaccaggctcaggtgcagcgg
tacctcagttcccgcacggagaaggctgctgtgctctcctgttatgcagtgttccccttc
cagcaggtgtccctctgcgtgggctgcctcattggcctggtcatgttcgcgtattaccag
gagtatcccatgagcattcagcaggctcaggcagccccagaccagttcgtcctgtacttt
gtgatggatctcctgaagggcctgccaggcctgccagggctcttcattgcctgcctcttc
agcggctctctcagcactatatcctctgcttttaattcattggcaactgttacgatggaa
gacctgattcgaccttggttccctgagttctctgaagcccgggccatcatgctttccaga
ggccttgcctttggctatgggctgctttgtctaggaatggcctatatttcctcccagatg
ggacctgtgctgcaggcagcaatcagcatctttggcatggttgggggaccgctgctggga
ctcttctgccttggaatgttctttccatgtgctaaccctcctggtgctgttgtgggcctg
ttggctgggctcgtcatggccttctggattggcatcgggagcatcgtgaccagcatgggc
tccagcatgccaccctctccctctaatgggtccagcttctccctgcccaccaatctaacc
gttgccactgtgaccacactgatgcccttgactaccttctccaagcccacagggctgcag
cggttctattccttgtcttacttatggtacagtgctcacaactccaccacagtgattgtg
gtgggcctgattgtcagtctactcactgggagaatgcgaggccggtccctgaaccctgca
accatttacccagtgttgccaaagctcctgtccctccttccgttgtcctgtcagaagcgg
ctccactgcaggagctacggccaggaccacctcgacactggcctgtttcctgagaagccg
aggaatggtgtgctgggggacagcagagacaaggaggccatggccctggatggcacagcc
tatcaggggagcagctccacctgcatcctccaggagacctccctgtga

DBGET integrated database retrieval system