KEGG   Homo sapiens (human): 8890Help
Entry
8890              CDS       T01001                                 

Gene name
EIF2B4, EIF-2B, EIF2B, EIF2Bdelta
Definition
eukaryotic translation initiation factor 2B, subunit 4 delta, 67kDa
Orthology
K03680  
translation initiation factor eIF-2B subunit delta
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
Disease
H00869  
Leukoencephalopathy with vanishing white matter
Class
Genetic Information Processing; Translation; RNA transport [PATH:hsa03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2p23.3
AA seq 523 aa AA seqDB search
MAAVAVAVREDSGSGMKAELPPGPGAVGREMTKEEKLQLRKEKKQQKKKRKEEKGAEPET
GSAVSAAQCQVGPTRELPESGIQLGTPREKVPAGRSKAELRAERRAKQEAERALKQARKG
EQGGPPPKASPSTAGETPSGVKRLPEYPQVDDLLLRRLVKKPERQQVPTRKDYGSKVSLF
SHLPQYSRQNSLTQFMSIPSSVIHPAMVRLGLQYSQGLVSGSNARCIALLRALQQVIQDY
TTPPNEELSRDLVNKLKPYMSFLTQCRPLSASMHNAIKFLNKEITSVGSSKREEEAKSEL
RAAIDRYVQEKIVLAAQAISRFAYQKISNGDVILVYGCSSLVSRILQEAWTEGRRFRVVV
VDSRPWLEGRHTLRSLVHAGVPASYLLIPAASYVLPEVSKVLLGAHALLANGSVMSRVGT
AQLALVARAHNVPVLVCCETYKFCERVQTDAFVSNELDDPDDLQCKRGEHVALANWQNHA
SLRLLNLVYDVTPPELVDLVITELGMIPCSSVPVVLRVKSSDQ
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgtggccgtggctgttcgcgaggactcgggatccgggatgaaggcggagctt
ccccctgggcctggggcagtggggagggaaatgaccaaagaagaaaagctgcagcttcgg
aaggaaaagaaacagcagaagaagaaacggaaggaagaaaagggggcagaaccagagact
ggctctgctgtatctgcagcccaatgtcaagtaggcccaaccagagaactgccagaatcg
ggcattcagttgggcactcctcgggagaaagttccagctggtcggagtaaggccgaactt
cgggctgagcgtcgagccaagcaggaggccgagcgggccctgaaacaggcaagaaaaggg
gaacaaggaggaccacctcctaaggccagccccagcacagctggagaaaccccctcagga
gtgaagcgtctccctgagtaccctcaggttgatgacctacttctgagaaggcttgttaaa
aaaccagagcgtcaacaggttcctacacgaaaggattatggatccaaagtcagtctcttc
tctcacctaccccagtacagcagacaaaactctctgacccagtttatgagcatcccatcc
tctgtgatccacccagccatggtgcgactcggcctgcagtactcccagggcctggtcagt
ggctccaatgcccggtgtattgccctgcttcgtgccttgcagcaggtgattcaggattac
acaacaccgcctaatgaagaactctccagggatctagtgaataaactaaaaccctacatg
agcttcctgactcagtgccgtcccctgtcagcgagcatgcacaacgccatcaagttcctt
aacaaggaaatcaccagtgtgggcagttccaagcgggaagaggaggccaagtcagaactt
cgagcagccattgatcggtatgtgcaagagaagattgtgctagcagctcaggcaatttca
cgctttgcttaccagaagatcagtaatggagatgtgatcctggtatatggatgctcatct
ctggtatcacgaattcttcaggaggcttggacagagggccggcggtttcgggtggtagtg
gtggacagccggccatggctggaaggaaggcacacactacgttctctagtccatgctggt
gtcccagcctcctacctgctgattcctgcagcctcctatgtgctcccagaggtttccaag
gtgctattgggagctcatgcactcttggccaacgggtctgtgatgtcacgggtagggaca
gcacagttagccctggtggctcgagcccataatgtaccagtgctggtttgctgtgaaaca
tacaagttctgtgagcgtgtgcagactgatgcctttgtctctaatgagctagatgaccct
gatgatctgcaatgtaagcggggagaacatgttgcgctggctaactggcagaaccacgca
tccctacggttgttgaatctagtctatgatgtgactcccccagagcttgtggatctggtg
atcacggagctggggatgatcccttgcagttctgtacctgttgttctacgagtcaagagc
agtgaccagtga

DBGET integrated database retrieval system