KEGG   Homo sapiens (human): 8891Help
Entry
8891              CDS       T01001                                 

Gene name
EIF2B3, EIF-2B, EIF2Bgamma
Definition
(RefSeq) eukaryotic translation initiation factor 2B subunit gamma
  KO
K03241  
translation initiation factor eIF-2B subunit gamma
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
Disease
H00869  
Leukoencephalopathy with vanishing white matter
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    8891 (EIF2B3)
Translation factors [BR:hsa03012]
 Eukaryotic Type
  Initiation factors
   eIF-2B
    8891 (EIF2B3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
Q9NR50(Tbio)
UniProt: 
Position
1p34.1
AA seq 452 aa AA seqDB search
MEFQAVVMAVGGGSRMTDLTSSIPKPLLPVGNKPLIWYPLNLLERVGFEEVIVVTTRDVQ
KALCAEFKMKMKPDIVCIPDDADMGTADSLRYIYPKLKTDVLVLSCDLITDVALHEVVDL
FRAYDASLAMLMRKGQDSIEPVPGQKGKKKAVEQRDFIGVDSTGKRLLFMANEADLDEEL
VIKGSILQKHPRIRFHTGLVDAHLYCLKKYIVDFLMENGSITSIRSELIPYLVRKQFSSA
SSQQGQEEKEEDLKKKELKSLDIYSFIKEANTLNLAPYDACWNACRGDRWEDLSRSQVRC
YVHIMKEGLCSRVSTLGLYMEANRQVPKLLSALCPEEPPVHSSAQIVSKHLVGVDSLIGP
ETQIGEKSSIKRSVIGSSCLIKDRVTITNCLLMNSVTVEEGSNIQGSVICNNAVIEKGAD
IKDCLIGSGQRIEAKAKRVNEVIVGNDQLMEI
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggaatttcaagcagtagtgatggcagtaggtggaggatctcggatgacagacctaact
tccagcattcccaaacctctgcttccagttgggaacaaacctttaatttggtacccattg
aacctgcttgagcgtgttggatttgaagaagtcattgtggttacaaccagggatgttcaa
aaggctctatgtgcagaattcaagatgaaaatgaagccagatattgtgtgtattcctgat
gacgctgacatgggaactgcagattctttgcgctacatatatccaaaacttaagacagat
gtgctggtgctgagctgtgatctgataacagacgttgccttacatgaggttgtggacctg
tttagagcttatgatgcatcacttgctatgttgatgagaaaaggccaagatagcatagaa
cctgttcccggtcaaaaggggaaaaaaaaagcagtggagcagcgtgacttcattggagtg
gacagcacaggaaagaggctgctcttcatggctaatgaagcagacttggatgaagagctg
gtcattaagggatccatcctacagaagcatcctagaatacgtttccacacgggtcttgtg
gatgcccacctctactgtttgaaaaaatacatcgtggatttcctaatggaaaatgggtca
ataacttctatccggagtgaactgattccatatttagtgagaaaacagttttcctcagct
tcctcacaacagggacaagaagaaaaagaggaggatctaaagaaaaaggagctgaagtcc
ttagatatctacagttttataaaagaagccaatacactgaacctggctccctatgatgcc
tgctggaatgcctgtcgaggagacaggtgggaagacttgtccagatcacaggtgcgctgc
tatgtccacatcatgaaagaggggctctgctctcgagtgagcacactgggactctacatg
gaagcaaacagacaggtgcccaaattgctgtctgctctctgtccagaagaaccaccagtc
cattcgtcagcccagattgtcagcaaacacctggttggagttgacagcctcattgggcca
gagacacagattggagagaagtcatccattaagcgctcagtcattggctcatcctgtctc
ataaaagatagagtgactattaccaattgccttctcatgaactcagtcactgtggaggaa
ggaagcaatatccaaggcagtgtcatctgcaacaatgctgtgatcgagaagggtgcagac
atcaaggactgcttgattggaagtggccagaggattgaagccaaagctaaacgagtgaat
gaggtgatcgtggggaatgaccagctcatggagatctga

DBGET integrated database retrieval system