KEGG   Homo sapiens (human): 8892Help
Entry
8892              CDS       T01001                                 

Gene name
EIF2B2, EIF-2Bbeta, EIF2B
Definition
eukaryotic translation initiation factor 2B, subunit 2 beta, 39kDa
Orthology
K03754  
translation initiation factor eIF-2B subunit beta
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
Disease
H00869  
Leukoencephalopathy with vanishing white matter
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    8892 (EIF2B2)
Translation factors [BR:hsa03012]
 Eukaryotic Type
  Initiation factors
   eIF-2B
    8892 (EIF2B2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Vega: 
UniProt: 
Position
14q24.3
AA seq 351 aa AA seqDB search
MPGSAAKGSELSERIESFVETLKRGGGPRSSEEMARETLGLLRQIITDHRWSNAGELMEL
IRREGRRMTAAQPSETTVGNMVRRVLKIIREEYGRLHGRSDESDQQESLHKLLTSGGLNE
DFSFHYAQLQSNIIEAINELLVELEGTMENIAAQALEHIHSNEVIMTIGFSRTVEAFLKE
AARKRKFHVIVAECAPFCQGHEMAVNLSKAGIETTVMTDAAIFAVMSRVNKVIIGTKTIL
ANGALRAVTGTHTLALAAKHHSTPLIVCAPMFKLSPQFPNEEDSFHKFVAPEEVLPFTEG
DILEKVSVHCPVFDYVPPELITLFISNIGGNAPSYIYRLMSELYHPDDHVL
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgccgggatccgcagcgaagggctcggagttgtcagagaggatcgagagcttcgtggag
accctgaagcggggtggtgggccgcgcagctccgaggaaatggctcgggagaccctaggg
ttgctgcgccagatcatcacggaccaccgctggagcaacgcgggggagctgatggagctg
atccgcagagagggcaggaggatgacggccgctcagccctccgagaccaccgtgggcaac
atggtgcggagagtgctcaagattatccgggaggagtatggcagactccatggacgcagc
gacgagagtgatcagcaggagtccctgcacaaactgttgacatccggaggcctaaacgag
gatttcagcttccattatgcccaactccagtccaacatcattgaggcgattaatgagctg
ctagtggagctggaagggacaatggagaacattgcagcccaggctctggagcacattcac
tccaatgaggtgatcatgaccattggcttctcccgaacagtagaggccttcctcaaagag
gctgcccgaaagaggaaattccatgtcattgtagcagagtgtgctcctttctgccagggt
catgaaatggctgtgaatttgtccaaagcaggtattgagacaactgtcatgactgatgct
gccatttttgccgttatgtcaagagtcaacaaggtgatcattggcacgaagaccatcctg
gccaatggggccctgagagctgtgacaggaactcacactctggcactggcagcaaaacac
cattccaccccactcatcgtctgtgcacctatgttcaaactttctccacagttccccaat
gaagaagactcatttcataagtttgtggctcctgaagaagtcctgccattcacagaaggg
gacattctggagaaggtcagcgtgcattgccctgtgtttgactacgttcccccagagctc
attaccctctttatctccaacattggtgggaatgcaccttcctacatctaccgcctgatg
agtgaactctaccatcctgatgatcatgttttatga

DBGET integrated database retrieval system