KEGG   Homo sapiens (human): 8896Help
Entry
8896              CDS       T01001                                 

Gene name
BUD31, Cwc14, EDG-2, EDG2, G10, YCR063W, fSAP17
Definition
BUD31 homolog (S. cerevisiae)
Orthology
K12873  
bud site selection protein 31
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Module
Spliceosome, 35S U5-snRNP
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    8896 (BUD31)
Spliceosome [BR:hsa03041]
 Complex B
  Other components
   Prp19-related factors
    8896 (BUD31)
 Complex C
    8896 (BUD31)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q22.1
AA seq 144 aa AA seqDB search
MPKVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIFRIHHQKTRYI
FDLFYKRKAISRELYEYCIKEGYADKNLIAKWKKQGYENLCCLRCIQTRDTNFGTNCICR
VPKSKLEVGRIIECTHCGCRGCSG
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgcctaaagtcaaaagaagccggaaagcacccccagatggctgggagttgattgagcca
acactggatgaattagatcaaaagatgagagaagctgaaacagaaccgcatgagggaaag
aggaaagtggaatctctgtggcccatcttcaggatccaccaccagaaaacccgctacatc
ttcgacctcttttacaagcggaaagccatcagcagagaactctatgaatattgtattaaa
gaaggctatgcagacaaaaacctgattgcaaaatggaaaaagcaaggatatgagaacttg
tgctgcctgcggtgcattcagacacgggacaccaacttcgggacgaactgcatctgccgc
gtgcccaaaagcaagctggaagtgggccgcatcatcgagtgcacacactgtggctgtcgt
ggctgctctggctga

DBGET integrated database retrieval system