KEGG   Homo sapiens (human): 8897Help
Entry
8897              CDS       T01001                                 

Gene name
MTMR3, FYVE-DSP1, ZFYVE10
Definition
(RefSeq) myotubularin related protein 3 (EC:3.1.3.48 3.1.3.64 3.1.3.95)
  KO
K18082  
myotubularin-related protein 3/4 [EC:3.1.3.48 3.1.3.64 3.1.3.95]
Organism
hsa  Homo sapiens (human)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    8897 (MTMR3)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    8897 (MTMR3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     8897 (MTMR3)
    3.1.3.64  phosphatidylinositol-3-phosphatase
     8897 (MTMR3)
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     8897 (MTMR3)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    8897 (MTMR3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
22q12.2
AA seq 1198 aa AA seqDB search
MDEETRHSLECIQANQIFPRKQLIREDENLQVPFLELHGESTEFVGRAEDAIIALSNYRL
HIKFKESLVNVPLQLIESVECRDIFQLHLTCKDCKVIRCQFSTFEQCQEWLKRLNNAIRP
PAKIEDLFSFAYHAWCMEVYASEKEQHGDLCRPGEHVTSRFKNEVERMGFDMNNAWRISN
INEKYKLCGSYPQELIVPAWITDKELESVSSFRSWKRIPAVIYRHQSNGAVIARCGQPEV
SWWGWRNADDEHLVQSVAKACASDSRSSGSKLSTRNTSRDFPNGGDLSDVEFDSSLSNAS
GAESLAIQPQKLLILDARSYAAAVANRAKGGGCECPEYYPNCEVVFMGMANIHSIRRSFQ
SLRLLCTQMPDPGNWLSALESTKWLHHLSVLLKSALLVVHAVDQDQRPVLVHCSDGWDRT
PQIVALAKLLLDPYYRTIEGFQVLVEMEWLDFGHKFADRCGHGENSDDLNERCPVFLQWL
DCVHQLQRQFPCSFEFNEAFLVKLVQHTYSCLFGTFLCNNAKERGEKHTQERTCSVWSLL
RAGNKAFKNLLYSSQSEAVLYPVCHVRNLMLWSAVYLPCPSPTTPVDDSCAPYPAPGTSP
DDPPLSRLPKTRSYDNLTTACDNTVPLASRRCSDPSLNEKWQEHRRSLELSSLAGPGEDP
LSADSLGKPTRVPGGAELSVAAGVAEGQMENILQEATKEESGVEEPAHRAGIEIQEGKED
PLLEKESRRKTPEASAIGLHQDPELGDAALRSHLDMSWPLFSQGISEQQSGLSVLLSSLQ
VPPRGEDSLEVPVEQFRIEEIAEGREEAVLPIPVDAKVGYGTSQSCSLLPSQVPFETRGP
NVDSSTDMLVEDKVKSVSGPQGHHRSCLVNSGKDRLPQTMEPSPSETSLVERPQVGSVVH
RTSLGSTLSLTRSPCALPLAECKEGLVCNGAPETENRASEQPPGLSTLQMYPTPNGHCAN
GEAGRSKDSLSRQLSAMSCSSAHLHSRNLHHKWLHSHSGRPSATSSPDQPSRSHLDDDGM
SVYTDTIQQRLRQIESGHQQEVETLKKQVQELKSRLESQYLTSSLHFNGDFGDEVTSIPD
SESNLDQNCLSRCSTEIFSEASWEQVDKQDTEMTRWLPDHLAAHCYACDSAFWLASRKHH
CRNCGNVFCSSCCNQKVPVPSQQLFEPSRVCKSCYSSLHPTSSSIDLELDKPIAATSN
NT seq 3597 nt NT seq  +upstreamnt  +downstreamnt
atggatgaagagactcggcacagccttgagtgcatccaggccaatcagatctttcccagg
aagcagctgatccgggaggatgagaatcttcaggttcctttccttgaacttcatggagag
agcacagagtttgtgggccgtgccgaggatgccatcattgccctttccaattacagactt
cacatcaagttcaaggagtctcttgttaatgttccattacagcttatagaaagtgttgaa
tgccgagatatatttcagcttcatttgacttgcaaagactgcaaagttatcaggtgtcag
ttttcaacctttgagcagtgtcaagagtggctgaagagactgaacaacgcaatccgacca
cctgctaaaatagaagatctcttctcatttgcataccatgcttggtgcatggaggtctat
gccagtgaaaaagagcaacatggagacctgtgcagaccaggggagcatgtaacttcaagg
tttaaaaacgaggtggagaggatgggttttgatatgaacaacgcctggaggatttccaac
atcaatgagaagtacaaattatgtggtagctatcctcaagagctcatagtgcctgcctgg
atcactgacaaagaactggaaagtgtatcaagtttcaggtcctggaagcgcatccctgcc
gtcatctacaggcaccagagcaatggagctgtcattgcccgctgtggacagccagaggtt
agctggtggggctggcgaaatgcagatgatgagcatctggtacagtcagtagccaaagct
tgtgcctctgactcccgatcgagtggcagcaagctgtcaactaggaacacttctcgagac
tttcccaatgggggagacctttctgacgtggagttcgattcttctctgtcaaatgcttca
ggagcagagagtttagccatccaaccgcagaagcttttgatcttggatgcacgctcctat
gcagctgctgtggcaaaccgagccaaaggaggaggctgcgaatgcccagagtattaccca
aactgtgaagttgtgtttatggggatggcaaacattcattctattcggaggagttttcag
tctctgcggttgctgtgcactcagatgccagatccgggaaattggctatcagctcttgaa
agcacaaaatggctccatcacttgtctgtgcttctgaaatcagcgcttctggtagtgcat
gctgtggatcaggatcagcggccggtgctagtacactgctcagatggctgggaccgcacc
ccccagattgtggcattggctaagctcttgctggacccttattaccgaaccatagagggt
ttccaggtcctcgtggaaatggagtggctggattttggccataaatttgctgaccggtgt
ggtcatggggagaactcggatgatctgaatgaacgttgcccagtgtttctgcagtggctt
gactgtgttcatcagcttcagaggcaatttccttgctcttttgagttcaatgaagcattc
cttgtgaaactggtgcagcatacctattcctgcctgtttggaacattcctgtgcaacaac
gccaaggagagaggggaaaagcatactcaggaacggacatgttccgtgtggtcacttctt
cgggcaggcaacaaggctttcaaaaacctactgtattcctctcagtcagaagccgtgctg
taccctgtgtgccatgtgcgtaacctgatgctgtggagtgcagtgtacctgccctgccca
tccccaaccacccctgtggacgacagctgtgcaccatacccagccccaggcaccagccct
gatgatccccccctgagccggctaccaaagactagatcatacgacaatctgaccacagcc
tgtgacaacacagtgcctctggccagccggcgctgcagcgaccccagcctgaacgagaag
tggcaggagcaccggcgctcactagagctgagcagcctggctggccctggagaggatccc
ctttctgccgacagcctagggaagcccaccagagtgccggggggtgccgagctttctgtt
gcagccggagtagctgaggggcagatggagaacatcttgcaggaggccaccaaagaggag
agtggagtagaggaacctgcccacagggcaggcattgagatacaggagggtaaagaggac
cctctcttagaaaaggagagcaggaggaagacacctgaggcctcagccattggacttcac
caagacccagaactgggtgatgctgctctgaggagccatctggatatgagctggcctctg
ttctcacagggcatttctgaacagcagagtgggctcagtgttctcctcagttctctccag
gtcccccccaggggagaggattccctggaggtccctgtggagcagtttcgaatagaagag
attgcagagggtagggaggaagcagttcttccaatcccagtagatgcaaaagttggctat
ggtacctcacagtcatgttctctgctaccttcccaagtcccttttgagaccagaggacca
aacgtggacagttctacagacatgttagtggaagataaggtgaagtcagtaagtgggccc
caaggtcatcatagatcttgccttgtaaatagtggcaaggacaggcttcctcagaccatg
gaacccagcccttcagagacaagcctggtcgagaggccccaagtggggtctgtggtgcat
aggacttcccttggcagcactctcagcctgacacgttccccttgtgccttgcctttagcc
gaatgtaaagaggggcttgtgtgcaatggtgccccagagactgaaaacagggcctcagag
cagcccccaggtcttagcaccctccagatgtaccccacacccaatgggcattgcgccaat
ggggaggctggtaggagcaaggactcactgagccgtcagctgtctgctatgagctgcagc
tctgcccacttacactcaaggaacttgcaccacaagtggctgcatagccactcaggaagg
ccatctgcaaccagcagccccgaccagccttcccgcagccacctggacgatgatggcatg
tcagtgtacacagacacgatccaacagcgcctgcgtcagattgagtcaggccaccagcag
gaagtagaaactttgaagaaacaagtccaggagctgaagagtcgcctggagagccagtac
ctgaccagctccctacactttaatggagactttggggatgaggtgacttcaatccccgac
tcggaaagcaatctggatcagaactgtttgtctcgctgcagcacagagattttctctgaa
gccagctgggagcaggtggataaacaggacacagagatgacccgttggcttcctgaccac
ctggccgcccactgctatgcgtgcgacagtgccttctggcttgccagcaggaagcaccac
tgcaggaattgtgggaacgtattctgctccagttgttgtaaccagaaggttccagttccc
agccagcagctctttgaacccagtcgagtatgcaagtcttgctatagcagcctacatccc
acaagctccagcattgaccttgaactggataagcccattgctgccacttccaactga

DBGET integrated database retrieval system