KEGG   Homo sapiens (human): 8899Help
Entry
8899              CDS       T01001                                 

Gene name
PRPF4B, PR4H, PRP4, PRP4H, PRP4K, dJ1013A10.1
Definition
(RefSeq) pre-mRNA processing factor 4B (EC:2.7.11.1)
  KO
K08827  
serine/threonine-protein kinase PRP4 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     8899 (PRPF4B)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   8899 (PRPF4B)
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    8899 (PRPF4B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p25.2
AA seq 1007 aa AA seqDB search
MAAAETQSLREQPEMEDANSEKSINEENGEVSEDQSQNKHSRHKKKKHKHRSKHKKHKHS
SEEDKDKKHKHKHKHKKHKRKEIIDASDKEGMSPAKRTKLDDLALLEDLEKQRALIKAEL
DNELMEGKVQSGMGLILQGYESGSEEEGEIHEKARNGNRSSTRSSSTKGKLELVDNKITT
KKRSKSRSKERTRHRSDKKKSKGGIEIVKEKTTRSKSKERKKSKSPSKRSKSQDQARKSK
SPTLRRRSQEKIGKARSPTDDKVKIEDKSKSKDRKKSPIINESRSRDRGKKSRSPVDLRG
KSKDRRSRSKERKSKRSETDKEKKPIKSPSKDASSGKENRSPSRRPGRSPKRRSLSPKPR
DKSRRSRSPLLNDRRSKQSKSPSRTLSPGRRAKSRSLERKRREPERRRLSSPRTRPRDDI
LSRRERSKDASPINRWSPTRRRSRSPIRRRSRSPLRRSRSPRRRSRSPRRRDRGRRSRSR
LRRRSRSRGGRRRRSRSKVKEDKFKGSLSEGMKVEQESSSDDNLEDFDVEEEDEEALIEQ
RRIQRQAIVQKYKYLAEDSNMSVPSEPSSPQSSTRTRSPSPDDILERVAADVKEYERENV
DTFEASVKAKHNLMTVEQNNGSSQKKLLAPDMFTESDDMFAAYFDSARLRAAGIGKDFKE
NPNLRDNWTDAEGYYRVNIGEVLDKRYNVYGYTGQGVFSNVVRARDNARANQEVAVKIIR
NNELMQKTGLKELEFLKKLNDADPDDKFHCLRLFRHFYHKQHLCLVFEPLSMNLREVLKK
YGKDVGLHIKAVRSYSQQLFLALKLLKRCNILHADIKPDNILVNESKTILKLCDFGSASH
VADNDITPYLVSRFYRAPEIIIGKSYDYGIDMWSVGCTLYELYTGKILFPGKTNNHMLKL
AMDLKGKMPNKMIRKGVFKDQHFDQNLNFMYIEVDKVTEREKVTVMSTINPTKDLLADLI
GCQRLPEDQRKKVHQLKDLLDQILMLDPAKRISINQALQHAFIQEKI
NT seq 3024 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgcggagacccagtcgctacgggagcagccagagatggaagatgctaattct
gaaaagagtataaatgaagaaaatggagaagtatcagaagaccagtctcaaaataagcac
agtcgtcacaaaaaaaagaagcataaacacagaagtaaacataagaaacataaacattcc
tcagaagaagacaaggataaaaaacataaacataagcataaacataagaaacacaaaaga
aaagagattattgatgcttctgataaagagggtatgtctccagcaaaaagaactaaactt
gatgatttagctttgctagaagacttggaaaaacagagagccttgattaaggccgaactt
gataatgagttaatggaaggaaaggtccagtctggtatggggctcattttgcaaggttat
gagtctggctctgaagaagagggggaaattcatgaaaaggcaagaaatggaaataggtct
agtactagatcttcaagtacaaaggggaaacttgaacttgtggacaataaaattactaca
aagaaacgaagtaaaagcagatccaaagaacggactagacataggtctgataaaaagaaa
agtaaggggggtattgaaatcgttaaagagaaaacaactaggagcaagtcaaaggagagg
aaaaaatctaaaagcccatccaaaagaagtaagtctcaagatcaagcaaggaaatcaaaa
tcccctacccttagaaggcgatctcaagagaaaattggtaaggccagatctcctactgat
gataaggttaaaattgaagataaaagtaaatcaaaagataggaaaaaatccccaattata
aatgaaagtagaagtcgcgatcgaggtaaaaaatccagatccccagttgatttaagaggt
aaatccaaagacagaaggtcacggtccaaagagagaaaatcaaaacggtctgaaactgat
aaagaaaagaagccaattaaatctccctctaaagatgcttcatctgggaaagaaaatagg
tcacccagcagaagacctggtcgtagtcctaaaagaagaagtttgtctccaaaaccacgt
gataaatcaagaagaagcaggtctccacttttgaatgatagaagatctaagcagagcaaa
tccccctcgcggacactgtctcctgggagaagagccaagagccgatccttagaaagaaaa
cgacgagaaccagagaggagacgactttcttctccaagaacacgacctcgagatgatatc
ctcagtagacgtgaaagatcaaaagatgccagccccatcaatagatggtctccaacccga
agaagaagtagatctcccattagaaggaggtctcgttccccactcagacgtagcaggtct
ccaagaagaagaagcagatctcctcggagaagggacagaggtcggaggagcagatcacgc
ttgcgaaggcggtctcgatcacgcggtggtcgtagacgaaggagcagaagcaaagtaaag
gaagataaatttaaaggaagtctttctgaaggaatgaaagttgagcaggaatcttcgtct
gatgataaccttgaagactttgatgtagaggaagaagatgaagaagccctaatagaacag
agaagaatccaaaggcaggcaattgttcagaaatataaataccttgctgaagatagcaac
atgtctgtgccatctgaaccaagcagcccccagagcagtacgagaacacgatcaccatct
ccagatgacattctggagcgagtagctgctgatgttaaagagtatgaacgggaaaatgtt
gatacatttgaggcctcagtgaaagccaagcataatctaatgacagttgaacagaataat
ggttcatctcagaagaagttgttggcacctgatatgtttacagaatctgatgatatgttt
gctgcgtattttgatagtgctcgtcttcgggccgctggcattggaaaagatttcaaagag
aatcccaacctcagagataactggaccgatgcagaaggctattatcgtgtgaacataggt
gaagtcctagataaacgttacaatgtgtatggctacactgggcaaggtgtattcagtaat
gttgtacgagccagagataatgcaagagccaaccaagaagtggctgtaaagatcatcaga
aacaatgagctcatgcaaaagactggtttaaaagaattagagttcttgaaaaaacttaat
gatgctgatcctgatgacaaatttcattgtctgagactcttcaggcacttctatcacaag
cagcatctttgtctggtattcgagcctctcagcatgaacttacgagaggtgttaaaaaaa
tatggtaaagatgttggtcttcatattaaagctgtaagatcctatagtcagcagttgttc
ctggcattgaaactccttaaaagatgcaatatcctacatgcagatatcaagccagacaat
atcctggttaatgaatccaaaactattttaaagctttgcgattttgggtcggcttcacat
gttgcggataatgacataacaccttatcttgtcagtagattttatcgtgctcctgaaatc
attataggtaaaagctatgactatggtatagatatgtggtctgtaggttgcaccttatac
gaactctatactggaaaaattttattccctggcaaaaccaataaccatatgctgaagctt
gcaatggatctcaaaggaaagatgccaaataagatgattcgaaaaggtgtgttcaaagat
cagcattttgatcaaaatctcaacttcatgtacatagaagttgataaagtaacagagagg
gagaaagttactgttatgagcaccattaatccaactaaggacctgttggctgacttgatt
gggtgccagagacttcctgaagaccaacgtaagaaagtacaccagctaaaggacttgttg
gaccagattctgatgttggacccagctaaacgaattagcatcaaccaggccctacagcac
gccttcatccaggaaaaaatttaa

DBGET integrated database retrieval system