KEGG   Homo sapiens (human): 8904Help
Entry
8904              CDS       T01001                                 

Gene name
CPNE1, COPN1, CPN1
Definition
(RefSeq) copine 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q99829(Tbio)
UniProt: 
Position
20q11.22
AA seq 537 aa AA seqDB search
MAHCVTLVQLSISCDHLIDKDIGSKSDPLCVLLQDVGGGSWAELGRTERVRNCSSPEFSK
TLQLEYRFETVQKLRFGIYDIDNKTPELRDDDFLGGAECSLGQIVSSQVLTLPLMLKPGK
PAGRGTITVSAQELKDNRVVTMEVEARNLDKKDFLGKSDPFLEFFRQGDGKWHLVYRSEV
IKNNLNPTWKRFSVPVQHFCGGNPSTPIQVQCSDYDSDGSHDLIGTFHTSLAQLQAVPAE
FECIHPEKQQKKKSYKNSGTIRVKICRVETEYSFLDYVMGGCQINFTVGVDFTGSNGDPS
SPDSLHYLSPTGVNEYLMALWSVGSVVQDYDSDKLFPAFGFGAQVPPDWQVSHEFALNFN
PSNPYCAGIQGIVDAYRQALPQVRLYGPTNFAPIINHVARFAAQAAHQGTASQYFMLLLL
TDGAVTDVEATREAVVRASNLPMSVIIVGVGGADFEAMEQLDADGGPLHTRSGQAAARDI
VQFVPYRRFQNAPREALAQTVLAEVPTQLVSYFRAQGWAPLKPLPPSAKDPAQAPQA
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atggcccactgcgtgaccttggttcagctgtccatttcctgtgaccatctcattgacaag
gacatcggctccaagtctgacccactctgcgtccttttacaggatgtgggagggggcagc
tgggctgagcttggccggactgaacgggtgcggaactgctcaagccctgagttctccaag
actctacagcttgagtaccgctttgagacagtccagaagctacgctttggaatctatgac
atagacaacaagacgccagagctgagggatgatgacttcctagggggtgctgagtgttcc
ctaggacagattgtgtccagccaggtactgactctccccttgatgctgaagcctggaaaa
cctgctgggcgggggaccatcacggtctcagctcaggaattaaaggacaatcgtgtagta
accatggaggtagaggccagaaacctagataagaaggacttcctgggaaaatcagatcca
tttctggagttcttccgccagggtgatgggaaatggcacctggtgtacagatctgaggtc
atcaagaacaacctgaaccctacatggaagcgtttctcagtccccgttcagcatttctgt
ggtgggaaccccagcacacccatccaggtgcaatgctccgattatgacagtgacgggtca
catgatctcatcggtaccttccacaccagcttggcccagctgcaggcagtcccggctgag
tttgaatgcatccaccctgagaagcagcagaaaaagaaaagctacaagaactctggaact
atccgtgtcaagatttgtcgggtagaaacagagtactcctttctggactatgtgatggga
ggctgtcagatcaacttcactgtgggcgtggacttcactggctccaatggagacccctcc
tcacctgactccctacactacctgagtccaacaggggtcaatgagtacctgatggcactg
tggagtgtgggcagcgtggttcaggactatgactcagacaagctgttccctgcatttgga
tttggggcccaggttccccctgactggcaggtctcgcatgaatttgccttgaatttcaac
cccagtaacccctactgtgcaggcatccagggcattgtggatgcctaccgccaagccctg
ccccaagttcgcctctatggccctaccaactttgcacccatcatcaaccatgtggccagg
tttgcagcccaggctgcacatcaggggactgcctcgcaatacttcatgctgttgctgctg
actgatggtgctgtgacggatgtggaagccacacgtgaggctgtggtgcgtgcctcgaac
ctgcccatgtcagtgatcattgtgggtgtgggtggtgctgactttgaggccatggagcag
ctggacgctgatggtggacccctgcatacacgttctgggcaggctgctgcccgcgacatt
gtgcagtttgtaccctaccgccggttccagaatgcccctcgggaggcattggcacagacc
gtgctcgcagaagtgcccacacaactggtctcatacttcagggcccagggttgggccccg
ctcaagccacttccaccctcagccaaggatcctgcacaggccccccaggcctag

DBGET integrated database retrieval system