KEGG   Homo sapiens (human): 8907Help
Entry
8907              CDS       T01001                                 

Gene name
AP1M1, AP47, CLAPM2, CLTNM, MU-1A
Definition
adaptor-related protein complex 1, mu 1 subunit
Orthology
K12393  
AP-1 complex subunit mu
Organism
hsa  Homo sapiens (human)
Pathway
Lysosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    8907 (AP1M1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.12
AA seq 435 aa AA seqDB search
MSASAVYVLDLKGKVLICRNYRGDVDMSEVEHFMPILMEKEEEGMLSPILAHGGVRFMWI
KHNNLYLVATSKKNACVSLVFSFLYKVVQVFSEYFKELEEESIRDNFVIIYELLDELMDF
GYPQTTDSKILQEYITQEGHKLETGAPRPPATVTNAVSWRSEGIKYRKNEVFLDVIESVN
LLGKYPGVGWLGHTVSANGNVLRSEIVGSIKMRVFLSGMPELRLGLNDKVLFDNTGRGKS
KSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLIWIESVIEKHSH
SRIEYMIKAKSQFKRRSTANNVEIHIPVPNDADSPKFKTTVGSVKWVPENSEIVWSIKSF
PGGKEYLMRAHFGLPSVEAEDKEGKPPISVKFEIPYFTTSGIQVRYLKIIEKSGYQALPW
VRYITQNGDYQLRTQ
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccagcgccgtctacgtgctggacctgaagggcaaggtgctcatctgccggaac
taccgtggcgacgtggacatgtcagaggtggagcacttcatgcccatcctgatggagaag
gaggaggaggggatgctgtcgcccatcctggcccacgggggggtccgtttcatgtggatc
aaacacaacaacctgtatctggttgccacatccaagaagaacgcgtgcgtgtcgctggtc
ttttctttcctctataaggtggtgcaggtgttttccgagtacttcaaggagctggaggag
gagagcatccgggacaactttgttatcatctacgagctgctggacgagctcatggacttc
ggctacccccagaccaccgacagcaagatcctgcaggagtacatcactcaggaaggccac
aagctggaaacaggggccccgcggccaccagccaccgtcaccaacgcggtgtcctggcgg
tccgaaggcatcaagtatcggaagaatgaggtgttcttggacgtcatcgagtctgtcaac
ctcttgggtaaatacccaggagtgggatggctgggtcacacggtcagcgccaacggcaat
gtcctgcgcagcgagatcgtgggctccatcaagatgcgagtcttcctctcgggcatgccc
gagctgcgcctgggcctcaacgacaaggtcctctttgacaacacgggccgcggcaaaagc
aaatccgtggagctggaggatgtgaagttccaccagtgtgtgcggctatcacgcttcgag
aatgaccgcaccatctccttcatcccacccgacggcgagttcgagctcatgtcctaccgt
ctcaacacccacgtcaagcctttgatatggatcgagtcggtgatcgagaagcactcccac
agccgcatcgagtacatgatcaaggccaaaagccagttcaagcggcggtcaacagccaac
aacgtggagatccacattcccgtgcccaatgatgccgactcacccaagttcaagacgacg
gtggggagcgttaagtgggtccccgagaacagcgagatcgtgtggtccatcaagtccttc
ccgggcggcaaggagtacctgatgcgggcccacttcggcctgcctagtgtggaggccgaa
gacaaggagggcaagcccccgatcagtgtcaagttcgagatcccttacttcactacctcc
ggcatccaggtgcgctacctgaagatcattgagaagagtgggtaccaggccctgccctgg
gtgcgttatatcacgcagaatggagattaccagctccggacccagtga

DBGET integrated database retrieval system