KEGG   Homo sapiens (human): 8915Help
Entry
8915              CDS       T01001                                 

Gene name
BCL10, CARMEN, CIPER, CLAP, c-E10, mE10
Definition
B-cell CLL/lymphoma 10
Orthology
K07368  
B-cell CLL/lymphoma 10
Organism
hsa  Homo sapiens (human)
Pathway
NF-kappa B signaling pathway
T cell receptor signaling pathway
B cell receptor signaling pathway
Tuberculosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    8915 (BCL10)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    8915 (BCL10)
   04662 B cell receptor signaling pathway
    8915 (BCL10)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    8915 (BCL10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p22
AA seq 233 aa AA seqDB search
MEPTAPSLTEEDLTEVKKDALENLRVYLCEKIIAERHFDHLRAKKILSREDTEEISCRTS
SRKRAGKLLDYLQENPKGLDTLVESIRREKTQNFLIQKITDEVLKLRNIKLEHLKGLKCS
SCEPFPDGATNNLSRSNSDESNFSEKLRASTVMYHPEGESSTTPFFSTNSSLNLPVLEVG
RTENTIFSSTTLPRPGDPGAPPLPPDLQLEEEGTCANSSEMFLPLRSRTVSRQ
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggagcccaccgcaccgtccctcaccgaggaggacctcactgaagtgaagaaggacgcc
ttagaaaatttacgtgtatacctgtgtgagaaaatcatagctgagagacattttgatcat
ctacgtgcaaaaaaaatactcagtagagaagacactgaagaaatttcttgtcgaacatca
agtagaaaaagggctggaaaattgttagactacttacaggaaaacccaaaaggtctggac
acccttgttgaatctattcggcgagaaaaaacacagaacttcctgatacagaagattaca
gatgaagtgctgaaacttagaaatataaaactagaacatctgaaaggactaaaatgtagc
agttgtgaaccttttccagatggagccacgaacaacctctccagatcaaattcagatgag
agtaatttctctgaaaaactgagggcatccactgtcatgtaccatccagaaggagaatcc
agcacgacgccctttttttctactaattcttctctgaatttgcctgttctagaagtaggc
agaactgaaaataccatcttctcttcaactacacttcccagacctggggacccaggggct
cctcctttgccaccagatctacagttagaagaagaaggaacttgtgcaaactctagtgag
atgtttcttcccttaagatcacgtactgtttcacgacaatga

DBGET integrated database retrieval system