KEGG   Homo sapiens (human): 8929Help
Entry
8929              CDS       T01001                                 

Gene name
PHOX2B, CCHS, NBLST2, NBPhox, PMX2B
Definition
(RefSeq) paired like homeobox 2b
  KO
K09330  paired mesoderm homeobox protein 2
Organism
hsa  Homo sapiens (human)
Disease
H00916  Congenital central hypoventilation syndrome (CCHS)
Brite
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, Prd
    8929 (PHOX2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeobox Homeobox_KN
Motif
Other DBs
NCBI-GeneID: 8929
NCBI-ProteinID: NP_003915
OMIM: 603851
HGNC: 9143
Ensembl: ENSG00000109132
Vega: OTTHUMG00000099379
Pharos: Q99453(Tbio)
UniProt: Q99453
Position
4p13
AA seq 314 aa AA seqDB search
MYKMEYSYLNSSAYESCMAGMDTSSLASAYADFSSCSQASGFQYNPIRTTFGATSGCPSL
TPGSCSLGTLRDHQSSPYAAVPYKLFTDHGGLNEKRKQRRIRTTFTSAQLKELERVFAET
HYPDIYTREELALKIDLTEARVQVWFQNRRAKFRKQERAAAAAAAAAKNGSSGKKSDSSR
DDESKEAKSTDPDSTGGPGPNPNPTPSCGANGGGGGGPSPAGAPGAAGPGGPGGEPGKGG
AAAAAAAAAAAAAAAAAAAAGGLAAAGGPGQGWAPGPGPITSIPDSLGGPFASVLSSLQR
PNGAKAALVKSSMF
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaatggaatattcttacctcaattcctctgcctacgagtcctgtatggctggg
atggacacctcgagcctggcttcagcctatgctgacttcagttcctgcagccaggccagt
ggcttccagtataacccgataaggaccacttttggggccacgtccggctgcccttccctc
acgccgggatcctgcagcctgggcaccctcagggaccaccagagcagtccgtacgccgca
gttccttacaaactcttcacggaccacggcggcctcaacgagaagcgcaagcagcggcgc
atccgcaccactttcaccagtgcccagctcaaagagctggaaagggtcttcgcggagact
cactaccccgacatctacactcgggaggagctggccctgaagatcgacctcacagaggcg
cgagtccaggtgtggttccagaaccgccgcgccaagtttcgcaagcaggagcgcgcagcg
gcagccgcagcggccgcggccaagaacggctcctcgggcaaaaagtctgactcttccagg
gacgacgagagcaaagaggccaagagcactgacccggacagcactgggggcccaggtccc
aatcccaaccccacccccagctgcggggcgaatggaggcggcggcggcgggcccagcccg
gctggagctccgggggcggcggggcccgggggcccgggaggcgaacccggcaagggcggc
gcagcagcagcggcggcggccgcggcagcggcggcggcggcagcggcagcggcggcagct
ggaggcctggctgcggctgggggccctggacaaggctgggctcccggccccggccccatc
acctccatcccggattcgcttgggggtcccttcgccagcgtcctatcttcgctccaaaga
cccaacggtgccaaagccgccttagtgaagagcagtatgttctga

DBGET integrated database retrieval system