KEGG   Homo sapiens (human): 8930Help
Entry
8930              CDS       T01001                                 

Gene name
MBD4, MED1
Definition
(RefSeq) methyl-CpG binding domain 4, DNA glycosylase
  KO
K10801  
methyl-CpG-binding domain protein 4 [EC:3.2.2.-]
Organism
hsa  Homo sapiens (human)
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    8930 (MBD4)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     8930 (MBD4)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Heterochromatin formation proteins
   MBPs (metylated DNA binding proteins)
    8930 (MBD4)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     8930 (MBD4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3q21.3
AA seq 580 aa AA seqDB search
MGTTGLESLSLGDRGAAPTVTSSERLVPDPPNDLRKEDVAMELERVGEDEEQMMIKRSSE
CNPLLQEPIASAQFGATAGTECRKSVPCGWERVVKQRLFGKTAGRFDVYFISPQGLKFRS
KSSLANYLHKNGETSLKPEDFDFTVLSKRGIKSRYKDCSMAALTSHLQNQSNNSNWNLRT
RSKCKKDVFMPPSSSSELQESRGLSNFTSTHLLLKEDEGVDDVNFRKVRKPKGKVTILKG
IPIKKTKKGCRKSCSGFVQSDSKRESVCNKADAESEPVAQKSQLDRTVCISDAGACGETL
SVTSEENSLVKKKERSLSSGSNFCSEQKTSGIINKFCSAKDSEHNEKYEDTFLESEEIGT
KVEVVERKEHLHTDILKRGSEMDNNCSPTRKDFTGEKIFQEDTIPRTQIERRKTSLYFSS
KYNKEALSPPRRKAFKKWTPPRSPFNLVQETLFHDPWKLLIATIFLNRTSGKMAIPVLWK
FLEKYPSAEVARTADWRDVSELLKPLGLYDLRAKTIVKFSDEYLTKQWKYPIELHGIGKY
GNDSYRIFCVNEWKQVHPEDHKLNKYHDWLWENHEKLSLS
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgggcacgactgggctggagagtctgagtctgggggaccgcggagctgcccccaccgtc
acctctagtgagcgcctagtcccagacccgccgaatgacctccgcaaagaagatgttgct
atggaattggaaagagtgggagaagatgaggaacaaatgatgataaaaagaagcagtgaa
tgtaatcccttgctacaagaacccatcgcttctgctcagtttggtgctactgcaggaaca
gaatgccgtaagtctgtcccatgtggatgggaaagagttgtgaagcaaaggttatttggg
aagacagcaggaagatttgatgtgtactttatcagcccacaaggactgaagttcagatcc
aaaagttcacttgctaattatcttcacaaaaatggagagacttctcttaagccagaagat
tttgattttactgtactttctaaaaggggtatcaagtcaagatataaagactgcagcatg
gcagccctgacatcccatctacaaaaccaaagtaacaattcaaactggaacctcaggacc
cgaagcaagtgcaaaaaggatgtgtttatgccgccaagtagtagttcagagttgcaggag
agcagaggactctctaactttacttccactcatttgcttttgaaagaagatgagggtgtt
gatgatgttaacttcagaaaggttagaaagcccaaaggaaaggtgactattttgaaagga
atcccaattaagaaaactaaaaaaggatgtaggaagagctgttcaggttttgttcaaagt
gatagcaaaagagaatctgtgtgtaataaagcagatgctgaaagtgaacctgttgcacaa
aaaagtcagcttgatagaactgtctgcatttctgatgctggagcatgtggtgagaccctc
agtgtgaccagtgaagaaaacagccttgtaaaaaaaaaagaaagatcattgagttcagga
tcaaatttttgttctgaacaaaaaacttctggcatcataaacaaattttgttcagccaaa
gactcagaacacaacgagaagtatgaggatacctttttagaatctgaagaaatcggaaca
aaagtagaagttgtggaaaggaaagaacatttgcatactgacattttaaaacgtggctct
gaaatggacaacaactgctcaccaaccaggaaagacttcactggtgagaaaatatttcaa
gaagataccatcccacgaacacagatagaaagaaggaaaacaagcctgtatttttccagc
aaatataacaaagaagctcttagccccccacgacgtaaagcctttaagaaatggacacct
cctcggtcaccttttaatctcgttcaagaaacactttttcatgatccatggaagcttctc
atcgctactatatttctcaatcggacctcaggcaaaatggcaatacctgtgctttggaag
tttctggagaagtatccttcagctgaggtagcaagaaccgcagactggagagatgtgtca
gaacttcttaaacctcttggtctctacgatcttcgggcaaaaaccattgtcaagttctca
gatgaatacctgacaaagcagtggaagtatccaattgagcttcatgggattggtaaatat
ggcaacgactcttaccgaattttttgtgtcaatgagtggaagcaggtgcaccctgaagac
cacaaattaaataaatatcatgactggctttgggaaaatcatgaaaaattaagtctatct
taa

DBGET integrated database retrieval system