KEGG   Homo sapiens (human): 8930Help
Entry
8930              CDS       T01001                                 

Gene name
MBD4, MED1
Definition
methyl-CpG binding domain protein 4
Orthology
K10801  
methyl-CpG-binding domain protein 4 [EC:3.2.2.-]
Organism
hsa  Homo sapiens (human)
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:hsa03410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3q21.3
AA seq 574 aa AA seqDB search
MGTTGLESLSLGDRGAAPTVTSSERLVPDPPNDLRKEDVAMELERVGEDEEQMMIKRSSE
CNPLLQEPIASAQFGATAGTECRKSVPCGWERVVKQRLFGKTAGRFDVYFISPQGLKFRS
KSSLANYLHKNGETSLKPEDFDFTVLSKRGIKSRYKDCSMAALTSHLQNQSNNSNWNLRT
RSKCKKDVFMPPSSSSELQESRGLSNFTSTHLLLKEDEGVDDVNFRKVRKPKGKVTILKG
IPIKKTKKGCRKSCSGFVQSDSKRESVCNKADAESEPVAQKSQLDRTVCISDAGACGETL
SVTSEENSLVKKKERSLSSGSNFCSEQKTSGIINKFCSAKDSEHNEKYEDTFLESEEIGT
KVEVVERKEHLHTDILKRGSEMDNNCSPTRKDFTEDTIPRTQIERRKTSLYFSSKYNKEA
LSPPRRKAFKKWTPPRSPFNLVQETLFHDPWKLLIATIFLNRTSGKMAIPVLWKFLEKYP
SAEVARTADWRDVSELLKPLGLYDLRAKTIVKFSDEYLTKQWKYPIELHGIGKYGNDSYR
IFCVNEWKQVHPEDHKLNKYHDWLWENHEKLSLS
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgggcacgactgggctggagagtctgagtctgggggaccgcggagctgcccccaccgtc
acctctagtgagcgcctagtcccagacccgccgaatgacctccgcaaagaagatgttgct
atggaattggaaagagtgggagaagatgaggaacaaatgatgataaaaagaagcagtgaa
tgtaatcccttgctacaagaacccatcgcttctgctcagtttggtgctactgcaggaaca
gaatgccgtaagtctgtcccatgtggatgggaaagagttgtgaagcaaaggttatttggg
aagacagcaggaagatttgatgtgtactttatcagcccacaaggactgaagttcagatcc
aaaagttcacttgctaattatcttcacaaaaatggagagacttctcttaagccagaagat
tttgattttactgtactttctaaaaggggtatcaagtcaagatataaagactgcagcatg
gcagccctgacatcccatctacaaaaccaaagtaacaattcaaactggaacctcaggacc
cgaagcaagtgcaaaaaggatgtgtttatgccgccaagtagtagttcagagttgcaggag
agcagaggactctctaactttacttccactcatttgcttttgaaagaagatgagggtgtt
gatgatgttaacttcagaaaggttagaaagcccaaaggaaaggtgactattttgaaagga
atcccaattaagaaaactaaaaaaggatgtaggaagagctgttcaggttttgttcaaagt
gatagcaaaagagaatctgtgtgtaataaagcagatgctgaaagtgaacctgttgcacaa
aaaagtcagcttgatagaactgtctgcatttctgatgctggagcatgtggtgagaccctc
agtgtgaccagtgaagaaaacagccttgtaaaaaaaaaagaaagatcattgagttcagga
tcaaatttttgttctgaacaaaaaacttctggcatcataaacaaattttgttcagccaaa
gactcagaacacaacgagaagtatgaggatacctttttagaatctgaagaaatcggaaca
aaagtagaagttgtggaaaggaaagaacatttgcatactgacattttaaaacgtggctct
gaaatggacaacaactgctcaccaaccaggaaagacttcactgaagataccatcccacga
acacagatagaaagaaggaaaacaagcctgtatttttccagcaaatataacaaagaagct
cttagccccccacgacgtaaagcctttaagaaatggacacctcctcggtcaccttttaat
ctcgttcaagaaacactttttcatgatccatggaagcttctcatcgctactatatttctc
aatcggacctcaggcaaaatggcaatacctgtgctttggaagtttctggagaagtatcct
tcagctgaggtagcaagaaccgcagactggagagatgtgtcagaacttcttaaacctctt
ggtctctacgatcttcgggcaaaaaccattgtcaagttctcagatgaatacctgacaaag
cagtggaagtatccaattgagcttcatgggattggtaaatatggcaacgactcttaccga
attttttgtgtcaatgagtggaagcaggtgcaccctgaagaccacaaattaaataaatat
catgactggctttgggaaaatcatgaaaaattaagtctatcttaa

DBGET integrated database retrieval system