KEGG   Homo sapiens (human): 8936Help
Entry
8936              CDS       T01001                                 

Gene name
WASF1, SCAR1, WAVE, WAVE1
Definition
WAS protein family, member 1
Orthology
K05753  
WAS protein family, member 1
Organism
hsa  Homo sapiens (human)
Pathway
Adherens junction
Fc gamma R-mediated phagocytosis
Regulation of actin cytoskeleton
Bacterial invasion of epithelial cells
Shigellosis
Salmonella infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    8936 (WASF1)
  Cell communication
   04520 Adherens junction
    8936 (WASF1)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    8936 (WASF1)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    8936 (WASF1)
   05131 Shigellosis
    8936 (WASF1)
   05100 Bacterial invasion of epithelial cells
    8936 (WASF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6q21
AA seq 559 aa AA seqDB search
MPLVKRNIDPRHLCHTALPRGIKNELECVTNISLANIIRQLSSLSKYAEDIFGELFNEAH
SFSFRVNSLQERVDRLSVSVTQLDPKEEELSLQDITMRKAFRSSTIQDQQLFDRKTLPIP
LQETYDVCEQPPPLNILTPYRDDGKEGLKFYTNPSYFFDLWKEKMLQDTEDKRKEKRKQK
QKNLDRPHEPEKVPRAPHDRRREWQKLAQGPELAEDDANLLHKHIEVANGPASHFETRPQ
TYVDHMDGSYSLSALPFSQMSELLTRAEERVLVRPHEPPPPPPMHGAGDAKPIPTCISSA
TGLIENRPQSPATGRTPVFVSPTPPPPPPPLPSALSTSSLRASMTSTPPPPVPPPPPPPA
TALQAPAVPPPPAPLQIAPGVLHPAPPPIAPPLVQPSPPVARAAPVCETVPVHPLPQGEV
QGLPPPPPPPPLPPPGIRPSSPVTVTALAHPPSGLHPTPSTAPGPHVPLMPPSPPSQVIP
ASEPKRHPSTLPVISDARSVLLEAIRKGIQLRKVEEQREQEAKHERIENDVATILSRRIA
VEYSDSEDDSEFDEVDWLE
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgccgctagtgaaaagaaacatcgatcctaggcacttgtgccacacagcactgcctaga
ggcattaagaatgaactggaatgtgtaaccaatatttccttggcaaatataattagacaa
ctaagtagcctaagtaaatatgctgaagatatatttggagaattattcaatgaagcacat
agtttttccttcagagtcaactcattgcaagaacgtgtggaccgtttatctgttagtgtt
acacagcttgatccaaaggaagaagaattgtctttgcaagatataacaatgaggaaagct
ttccgaagttctacaattcaagaccagcagcttttcgatcgcaagactttgcctattcca
ttacaggagacgtacgatgtttgtgaacagcctccacctctcaatatactcactccttat
agagatgatggtaaagaaggtctgaagttttataccaatccttcgtatttctttgatcta
tggaaagaaaaaatgttgcaagatacagaggataagaggaaggaaaagaggaagcagaag
cagaaaaatctagatcgtcctcatgaaccagaaaaagtgccaagagcacctcatgacagg
cggcgagaatggcagaagctggcccaaggtccagagctggctgaagatgatgctaatctc
ttacataagcatattgaagttgctaatggcccagcctctcattttgaaacaagacctcag
acatacgtggatcatatggatggatcttactcactttctgccttgccatttagtcagatg
agtgagcttctgactagagctgaggaaagggtattagtcagaccacatgaaccacctcca
cctccaccaatgcatggagcaggagatgcaaaaccgatacccacctgtatcagttctgct
acaggtttgatagaaaatcgccctcagtcaccagctacaggcagaacacctgtgtttgtg
agccccactcccccacctcctccaccacctcttccatctgccttgtcaacttcctcatta
agagcttcaatgacttcaactcctccccctccagtacctcccccacctccacctccagcc
actgctttgcaagctccagcagtaccaccacctccagctcctcttcagattgcccctgga
gttcttcacccagctcctcctccaattgcacctcctctagtacagccctctccaccagta
gctagagctgccccagtatgtgagactgtaccagttcatccactcccacaaggtgaagtt
caggggctgcctccacccccaccaccgcctcctctgcctccacctggcattcgaccatca
tcacctgtcacagttacagctcttgctcatcctccctctgggctacatccaactccatct
actgccccaggtccccatgttccattaatgcctccatctcctccatcacaagttatacct
gcttctgagccaaagcgccatccatcaaccctacctgtaatcagtgatgccaggagtgtg
ctactggaagcaatacgaaaaggtattcagctacgcaaagtagaagagcagcgtgaacag
gaagctaagcatgaacgcattgaaaacgatgttgccaccatcctgtctcgccgtattgct
gttgaatatagtgattcggaagatgattcagaatttgatgaagtagattggttggagtaa

DBGET integrated database retrieval system