KEGG   Homo sapiens (human): 894Help
Entry
894               CDS       T01001                                 

Gene name
CCND2, KIAK0002, MPPH3
Definition
(RefSeq) cyclin D2
  KO
K10151  
G1/S-specific cyclin-D2
Organism
hsa  Homo sapiens (human)
Pathway
FoxO signaling pathway
Cell cycle
p53 signaling pathway
PI3K-Akt signaling pathway
Cellular senescence
Wnt signaling pathway
Hedgehog signaling pathway
Hippo signaling pathway
Focal adhesion
Jak-STAT signaling pathway
Prolactin signaling pathway
Measles
Human papillomavirus infection
HTLV-I infection
Pathways in cancer
Transcriptional misregulation in cancer
Viral carcinogenesis
MicroRNAs in cancer
Module
Cell cycle - G1/S transition
Network
N00066  
p21-Cell cycle G1/S
N00067  
Deleted p14(ARF) to p21-cell cycle G1/S
N00068  
Amplified MDM2 to p21-cell cycle G1/S
N00069  
p16-Cell cycle G1/S
N00070  
Mutation-inactivated p16(INK4a) to p16-cell cycle G1/S
N00071  
Deleted p16(INK4a) to p16-cell cycle G1/S
N00072  
Amplified CDK4 to cell cycle G1/S
N00073  
Mutation-activated CDK4 to cell cycle G1/S
N00076  
Mutation-inactivated p14(ARF) to p21-cell cycle G1/S
N00088  
Amplified MYC to p15-cell cycle G1/S
N00089  
Amplified MYC to cell cycle G1/S
N00090  
p15-Cell cycle G1/S
N00123  
Amplified REL to transcription
N00124  
IGH-MAF fusion to transcriptional activation
N00125  
IGH-MMSET fusion to transcriptional activation
N00221  
HTLV-I Tax to host-cell-protein activation
N00263  
EBV EBNA3C to host-cell-protein activation
Disease
H00023  
Testicular cancer
H01885  
Megalencephaly-capillary malformation syndrome (MCAP) and megalencephaly-polymicrogyria-polydactyly-hydrocephalus syndrome (MPPH)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    894 (CCND2)
   04340 Hedgehog signaling pathway
    894 (CCND2)
   04390 Hippo signaling pathway
    894 (CCND2)
   04630 Jak-STAT signaling pathway
    894 (CCND2)
   04068 FoxO signaling pathway
    894 (CCND2)
   04151 PI3K-Akt signaling pathway
    894 (CCND2)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    894 (CCND2)
   04115 p53 signaling pathway
    894 (CCND2)
   04218 Cellular senescence
    894 (CCND2)
  Cellular community - eukaryotes
   04510 Focal adhesion
    894 (CCND2)
 Organismal Systems
  Endocrine system
   04917 Prolactin signaling pathway
    894 (CCND2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    894 (CCND2)
   05202 Transcriptional misregulation in cancers
    894 (CCND2)
   05206 MicroRNAs in cancer
    894 (CCND2)
   05203 Viral carcinogenesis
    894 (CCND2)
  Infectious diseases
   05166 HTLV-I infection
    894 (CCND2)
   05162 Measles
    894 (CCND2)
   05165 Human papillomavirus infection
    894 (CCND2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P30279(Tbio)
UniProt: 
Position
12p13.32
AA seq 289 aa AA seqDB search
MELLCHEVDPVRRAVRDRNLLRDDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVA
TWMLEVCEEQKCEEEVFPLAMNYLDRFLAGVPTPKSHLQLLGAVCMFLASKLKETSPLTA
EKLCIYTDNSIKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQQREKLSLIRKH
AQTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDEEVSSLTCDALTELLAKITNTDV
DCLKACQEQIEAVLLNSLQQYRQDQRDGSKSEDELDQASTPTDVRDIDL
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atggagctgctgtgccacgaggtggacccggtccgcagggccgtgcgggaccgcaacctg
ctccgagacgaccgcgtcctgcagaacctgctcaccatcgaggagcgctaccttccgcag
tgctcctacttcaagtgcgtgcagaaggacatccaaccctacatgcgcagaatggtggcc
acctggatgctggaggtctgtgaggaacagaagtgcgaagaagaggtcttccctctggcc
atgaattacctggaccgtttcttggctggggtcccgactccgaagtcccatctgcaactc
ctgggtgctgtctgcatgttcctggcctccaaactcaaagagaccagcccgctgaccgcg
gagaagctgtgcatttacaccgacaactccatcaagcctcaggagctgctggagtgggaa
ctggtggtgctggggaagttgaagtggaacctggcagctgtcactcctcatgacttcatt
gagcacatcttgcgcaagctgccccagcagcgggagaagctgtctctgatccgcaagcat
gctcagaccttcattgctctgtgtgccaccgactttaagtttgccatgtacccaccgtcg
atgatcgcaactggaagtgtgggagcagccatctgtgggctccagcaggatgaggaagtg
agctcgctcacttgtgatgccctgactgagctgctggctaagatcaccaacacagacgtg
gattgtctcaaagcttgccaggagcagattgaggcggtgctcctcaatagcctgcagcag
taccgtcaggaccaacgtgacggatccaagtcggaggatgaactggaccaagccagcacc
cctacagacgtgcgggatatcgacctgtga

DBGET integrated database retrieval system