KEGG   Homo sapiens (human): 8972Help
Entry
8972              CDS       T01001                                 

Gene name
MGAM, MG, MGA
Definition
maltase-glucoamylase (alpha-glucosidase) (EC:3.2.1.20 3.2.1.3)
Orthology
K12047  
maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Carbohydrate digestion and absorption
Drug target
Acarbose: 
Miglitol: 
Voglibose: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    8972 (MGAM)
   00500 Starch and sucrose metabolism
    8972 (MGAM)
 Organismal Systems
  Digestive system
   04973 Carbohydrate digestion and absorption
    8972 (MGAM)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     8972 (MGAM)
    3.2.1.20  alpha-glucosidase
     8972 (MGAM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q34
AA seq 1857 aa AA seqDB search
MARKKLKKFTTLEIVLSVLLLVLFIISIVLIVLLAKESLKSTAPDPGTTGTPDPGTTGTP
DPGTTGTTHARTTGPPDPGTTGTTPVSAECPVVNELERINCIPDQPPTKATCDQRGCCWN
PQGAVSVPWCYYSKNHSYHVEGNLVNTNAGFTARLKNLPSSPVFGSNVDNVLLTAEYQTS
NRFHFKLTDQTNNRFEVPHEHVQSFSGNAAASLTYQVEISRQPFSIKVTRRSNNRVLFDS
SIGPLLFADQFLQLSTRLPSTNVYGLGEHVHQQYRHDMNWKTWPIFNRDTTPNGNGTNLY
GAQTFFLCLEDASGLSFGVFLMNSNAMEVVLQPAPAITYRTIGGILDFYVFLGNTPEQVV
QEYLELIGRPALPSYWALGFHLSRYEYGTLDNMREVVERNRAAQLPYDVQHADIDYMDER
RDFTYDSVDFKGFPEFVNELHNNGQKLVIIVDPAISNNSSSSKPYGPYDRGSDMKIWVNS
SDGVTPLIGEVWPGQTVFPDYTNPNCAVWWTKEFELFHNQVEFDGIWIDMNEVSNFVDGS
VSGCSTNNLNNPPFTPRILDGYLFCKTLCMDAVQHWGKQYDIHNLYGYSMAVATAEAAKT
VFPNKRSFILTRSTFAGSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGPDICG
FALDTPEELCRRWMQLGAFYPFSRNHNGQGYKDQDPASFGADSLLLNSSRHYLNIRYTLL
PYLYTLFFRAHSRGDTVARPLLHEFYEDNSTWDVHQQFLWGPGLLITPVLDEGAEKVMAY
VPDAVWYDYETGSQVRWRKQKVEMELPGDKIGLHLRGGYIFPTQQPNTTTLASRKNPLGL
IIALDENKEAKGELFWDNGETKDTVANKVYLLCEFSVTQNRLEVNISQSTYKDPNNLAFN
EIKILGTEEPSNVTVKHNGVPSQTSPTVTYDSNLKVAIITDIDLLLGEAYTVEWSIKIRD
EEKIDCYPDENGASAENCTARGCIWEASNSSGVPFCYFVNDLYSVSDVQYNSHGATADIS
LKSSVYANAFPSTPVNPLRLDVTYHKNEMLQFKIYDPNKNRYEVPVPLNIPSMPSSTPEG
QLYDVLIKKNPFGIEIRRKSTGTIIWDSQLLGFTFSDMFIRISTRLPSKYLYGFGETEHR
SYRRDLEWHTWGMFSRDQPPGYKKNSYGVHPYYMGLEEDGSAHGVLLLNSNAMDVTFQPL
PALTYRTTGGVLDFYVFLGPTPELVTQQYTELIGRPVMVPYWSLGFQLCRYGYQNDSEIA
SLYDEMVAAQIPYDVQYSDIDYMERQLDFTLSPKFAGFPALINRMKADGMRVILILDPAI
SGNETQPYPAFTRGVEDDVFIKYPNDGDIVWGKVWPDFPDVVVNGSLDWDSQVELYRAYV
AFPDFFRNSTAKWWKREIEELYNNPQNPERSLKFDGMWIDMNEPSSFVNGAVSPGCRDAS
LNHPPYMPHLESRDRGLSSKTLCMESQQILPDGSLVQHYNVHNLYGWSQTRPTYEAVQEV
TGQRGVVITRSTFPSSGRWAGHWLGDNTAAWDQLKKSIIGMMEFSLFGISYTGADICGFF
QDAEYEMCVRWMQLGAFYPFSRNHNTIGTRRQDPVSWDVAFVNISRTVLQTRYTLLPYLY
TLMHKAHTEGVTVVRPLLHEFVSDQVTWDIDSQFLLGPAFLVSPVLERNARNVTAYFPRA
RWYDYYTGVDINARGEWKTLPAPLDHINLHVRGGYILPWQEPALNTHLSRQKFMGFKIAL
DDEGTAGGWLFWDDGQSIDTYGKGLYYLASFSASQNTMQSHIIFNNYITGTNPLKLGYIE
IWGVGSVPVTSVSISVSGMVITPSFNNDPTTQVLSIDVTDRNISLHNFTSLTWISTL
NT seq 5574 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaaagaagctgaaaaaatttactactttggagattgtgctcagtgttcttctg
cttgtgttgtttatcatcagtattgttctaattgtgcttttagccaaagagtcactgaaa
tcaacagccccagatcctgggacaactggtaccccagatcctgggacaactggtacccca
gatcctggaacaactggtaccacacatgctaggacaacgggtcccccagatcctggaaca
actggtaccactcctgtttctgctgaatgtccagtggtaaatgaattggaacgaattaat
tgcatccctgaccagccgccaacaaaggccacatgtgaccaacgtggctgttgctggaat
ccccagggagctgtaagtgttccctggtgctactattccaagaatcatagctaccatgta
gagggcaaccttgtcaacacaaatgcaggattcacagcccggttgaaaaatctgccttct
tcaccagtgtttggaagcaatgttgacaatgttcttctcacagcagaatatcagacatct
aatcgtttccactttaagttgactgaccaaaccaataacaggtttgaagtgccccacgaa
cacgtgcagtccttcagtggaaatgctgctgcttctttgacctaccaagttgaaatctcc
agacagccatttagcatcaaagtgaccagaagaagcaacaatcgtgttttgtttgactcg
agcattgggcccctactgtttgctgaccagttcttgcagctctccactcgactgcctagc
actaacgtgtatggcctgggagagcatgtgcaccagcagtatcggcatgatatgaattgg
aagacctggcccatatttaacagagacacaactcccaatggaaacggaactaatttgtat
ggtgcgcagacattcttcttgtgccttgaagatgctagtggattgtcctttggggtgttt
ctgatgaacagcaatgccatggaggttgtccttcagcctgcgccagccatcacttaccgc
accattgggggcattctcgacttctatgtgttcttgggaaacactccagagcaagttgtt
caagaatatctagagctcattgggcggccagcccttccctcctactgggcgcttggattt
cacctcagtcgttacgaatatggaaccttagacaacatgagggaagtcgtggagagaaat
cgcgcagcacagctcccttatgatgttcagcatgctgatattgattatatggatgagaga
agggacttcacttatgattcagtggattttaaaggcttccctgaatttgtcaacgagtta
cacaataatggacagaagcttgtcatcattgtggatccagccatctccaacaactcttcc
tcaagtaaaccctatggcccatatgacaggggttcagatatgaagatatgggtgaatagt
tcagatggagtgactccactcattggggaggtctggcctggacaaactgtgtttcctgat
tataccaatcccaactgtgctgtttggtggacaaaggaatttgagctttttcacaatcaa
gtagagtttgatggaatctggattgatatgaatgaagtctccaactttgttgatggttcg
gtctcaggatgttccacaaacaacctaaataatcccccattcactcccagaatcctggat
gggtacctgttctgcaagactctctgtatggatgcagtgcagcactggggcaagcagtat
gacattcacaatctgtatggctactccatggcggtcgccacagcagaagctgccaagact
gtgttccctaataagagaagcttcattctgacccgttctacctttgcgggctctggcaag
tttgcagcacattggttaggagacaacactgccacctgggatgacctgagatggtccatc
cctggcgtgcttgagttcaacctttttggcatcccaatggtgggtcctgacatatgtggc
tttgctttggacacccctgaggagctctgtaggcggtggatgcagttgggtgcattttat
ccgttttctagaaatcacaatggccaaggctacaaggaccaggatcctgcctcctttgga
gctgactccctgctgttgaattcctccaggcactaccttaacatccgctatactctattg
ccctacctatacaccctcttcttccgtgctcacagccgaggggacacggtggccaggccc
cttttgcatgagttctacgaggacaacagcacttgggatgtgcaccaacagttcttatgg
gggcccggcctcctcatcactccagttctggatgaaggtgcagagaaagtgatggcatat
gtgcctgatgctgtctggtatgactacgagactgggagccaagtgagatggaggaagcaa
aaagtcgagatggaacttcctggagacaaaattggacttcaccttcgaggaggctacatc
ttccccacacagcagccaaatacaaccactctggccagtcgaaagaaccctcttggtctt
atcattgccctagatgagaacaaagaagcaaaaggagaacttttctgggataatggggaa
acgaaggatactgtggccaataaagtgtatcttttatgtgagttttctgtcactcaaaac
cgcttggaggtgaatatttcacaatcaacctacaaggaccccaataatttagcatttaat
gagattaaaattcttgggacggaggaacctagcaatgttacagtgaaacacaatggtgtc
ccaagtcagacttctcctacagtcacttatgattctaacctgaaggttgccattatcaca
gatattgatcttctcctgggagaagcatacacagtggaatggagcataaagataagggat
gaagaaaaaatagactgttaccctgatgagaatggtgcttctgccgaaaactgcactgcc
cgtggctgtatctgggaggcatccaattcttctggagtccctttttgctattttgtcaac
gacctatactctgtcagtgatgttcagtataattcccatggggccacagctgacatctcc
ttaaagtcttccgtttatgccaatgccttcccctccacacccgtgaacccccttcgcctg
gatgtcacttaccataagaatgaaatgctgcagttcaagatttatgatcccaacaagaat
cggtatgaagttccagtccctctgaacatacccagcatgccatccagcacccctgagggt
caactctatgatgtgctcattaagaagaatccatttgggattgaaattcgccggaagagt
acaggcactataatttgggactctcagctccttggctttaccttcagtgacatgtttatc
cgcatctccacccgccttccctccaagtacctctatggctttggggaaactgagcacagg
tcctataggagagacttggagtggcacacttgggggatgttctcccgagaccagccccca
gggtacaagaagaattcctatggtgtccacccctactacatggggctggaggaggacggc
agtgcccatggagtgctcctgctgaacagcaatgccatggatgtgacgttccagcccctg
cctgccttgacataccgcaccacagggggagttctggacttttatgtgttcttggggccg
actccagagcttgtcacccagcagtacactgagttgattggccggcctgtgatggtacct
tactggtctttggggttccagctgtgtcgctatggctaccagaatgactctgagatcgcc
agcttgtatgatgagatggtggctgcccagatcccttatgatgtgcagtactcagacatc
gactacatggagcggcagctggacttcaccctcagccccaagtttgctgggtttccagct
ctgatcaatcgcatgaaggctgatgggatgcgggtcatcctcattctggatccagccatt
tctggcaatgagacacagccttatcctgccttcactcggggcgtggaggatgacgtcttc
atcaaatacccaaatgatggagacattgtctggggaaaggtctggcctgattttcctgat
gttgttgtgaatgggtctctagactgggacagccaagtggagctatatcgagcttatgtg
gccttcccagactttttccgtaattcaactgccaagtggtggaagagggaaatagaagaa
ctatacaacaatccacagaatccagagaggagcttgaagtttgatggcatgtggattgat
atgaatgaaccatcaagcttcgtgaatggggcagtttctccaggctgcagggacgcctct
ctgaaccaccctccctacatgccacatttggagtccagggacaggggcctgagcagcaag
accctttgtatggagagtcagcagatcctcccagacggctccctggtgcagcactacaac
gtgcacaacctgtatgggtggtcccagaccagacccacatacgaagccgtgcaggaggtg
acgggacagcgaggggtcgtcatcacccgctccacatttccctcttctggccgctgggca
ggacattggctgggagacaacacggccgcatgggatcagctgaagaagtctatcattggc
atgatggagttcagcctcttcggcatatcctatacgggagcagatatctgtgggttcttt
caagatgctgaatatgagatgtgtgttcgctggatgcagctgggggccttttaccccttc
tcaagaaaccacaacaccattgggaccaggagacaagaccctgtgtcctgggatgttgct
tttgtgaatatttccagaactgtcctgcagaccagatacaccctgttgccatatctgtat
accttgatgcataaggcccacacggagggcgtcactgttgtgcggcctctgctccatgag
tttgtgtcagaccaggtgacatgggacatagacagtcagttcctgctgggcccagccttc
ctggtcagccctgtcctggagcgtaatgccagaaatgtcactgcatatttccctagagcc
cgctggtatgattactacacgggtgtggatattaatgcaagaggagagtggaagaccttg
ccagcccctcttgaccacattaatcttcatgtccgtgggggctacatcctgccctggcaa
gagcctgcactgaacacccacttaagccgccagaaattcatgggcttcaaaattgccttg
gatgatgaaggaactgctgggggctggctcttctgggatgatgggcaaagcattgatacc
tatgggaaaggactctattacttggccagcttttctgccagccagaatacgatgcaaagc
catataattttcaacaattacatcactggtacaaatcctttgaaactgggctacattgaa
atctggggagtgggcagtgtccccgttaccagtgtcagcatctctgtgagtggcatggtc
ataacaccctccttcaacaatgaccccacgacacaggtattaagcatcgatgtgactgac
agaaacatcagcctacataattttacttcattgacgtggataagcactctgtga

DBGET integrated database retrieval system