KEGG   Homo sapiens (human): 8973Help
Entry
8973              CDS       T01001                                 

Gene name
CHRNA6, CHNRA6
Definition
(RefSeq) cholinergic receptor nicotinic alpha 6 subunit
  KO
K04808  
nicotinic acetylcholine receptor alpha-6
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Cholinergic synapse
Nicotine addiction
Drug target
Acetylcholine (DG01133): 
Hexamethonium bromide: 
Lobeline (DG01287): 
Mecamylamine (DG00252): 
Trimetaphan (DG00251): 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    8973 (CHRNA6)
 Organismal Systems
  Nervous system
   04725 Cholinergic synapse
    8973 (CHRNA6)
 Human Diseases
  Substance dependence
   05033 Nicotine addiction
    8973 (CHRNA6)
Ion channels [BR:hsa04040]
 Cys-loop superfamily
  Acetylcholine (nicotinic)
   8973 (CHRNA6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8p11.21
AA seq 494 aa AA seqDB search
MLTSKGQGFLHGGLCLWLCVFTPFFKGCVGCATEERLFHKLFSHYNQFIRPVENVSDPVT
VHFEVAITQLANVDEVNQIMETNLWLRHIWNDYKLRWDPMEYDGIETLRVPADKIWKPDI
VLYNNAVGDFQVEGKTKALLKYNGMITWTPPAIFKSSCPMDITFFPFDHQNCSLKFGSWT
YDKAEIDLLIIGSKVDMNDFWENSEWEIIDASGYKHDIKYNCCEEIYTDITYSFYIRRLP
MFYTINLIIPCLFISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVV
PLVGEYLLFTMIFVTLSIVVTVFVLNIHYRTPTTHTMPRWVKTVFLKLLPQVLLMRWPLD
KTRGTGSDAVPRGLARRPAKGKLASHGEPRHLKECFHCHKSNELATSKRRLSHQPLQWVV
ENSEHSPEVEDVINSVQFIAENMKSHNETKEVEDDWKYVAMVVDRVFLWVFIIVCVFGTA
GLFLQPLLGNTGKS
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgctgaccagcaaggggcagggattccttcatgggggcttgtgtctctggctgtgtgtg
ttcacacctttctttaaaggctgtgtgggctgtgcaactgaggagaggctcttccacaaa
ctgttttctcattacaaccagttcatcaggcctgtggaaaacgtttccgaccctgtcacg
gtacactttgaagtggccatcacccagctggccaacgtggatgaagtaaaccagatcatg
gaaaccaatttgtggctgcgtcacatctggaatgattataaattgcgctgggatccaatg
gaatatgatggcattgagactcttcgcgttcctgcagataagatttggaagcccgacatt
gttctctataacaatgctgttggtgacttccaagtagaaggcaaaacaaaagctcttctt
aaatacaatggcatgataacctggactccaccagctatttttaagagttcctgccctatg
gatatcacctttttcccttttgatcatcaaaactgttccctaaaatttggttcctggacg
tatgacaaagctgaaattgatcttctaatcattggatcaaaagtggatatgaatgatttt
tgggaaaacagtgaatgggaaatcattgatgcctctggctacaaacatgacatcaaatac
aactgttgtgaagagatatacacagatataacctattctttctacattagaagattgccg
atgttttacacgattaatctgatcatcccttgtctctttatttcatttctaaccgtgttg
gtcttttaccttccttcggactgtggtgaaaaagtgacgctttgtatttcagtcctgctt
tctctgactgtgtttttgctggtcatcacagaaaccatcccatccacatctctggtggtc
ccactggtgggtgagtacctgctgttcaccatgatctttgtcacactgtccatcgtggtg
actgtgtttgtgttgaacatacactaccgcaccccaaccacgcacacaatgcccaggtgg
gtgaagacagttttcctgaagctgctgccccaggtcctgctgatgaggtggcctctggac
aagacaaggggcacaggctctgatgcagtgcccagaggccttgccaggaggcctgccaaa
ggcaagcttgcaagccatggggaacccagacatcttaaagaatgcttccattgtcacaaa
tcaaatgagcttgccacaagcaagagaagattaagtcatcagccattacagtgggtggtg
gaaaattcggagcactcgcctgaagttgaagatgtgattaacagtgttcagttcatagca
gaaaacatgaagagccacaatgaaaccaaggaggtagaagatgactggaaatacgtggcc
atggtggtggacagagtatttctttgggtatttataattgtctgtgtatttggaactgca
gggctatttctacagccactacttgggaacacaggaaaatcttaa

DBGET integrated database retrieval system