KEGG   Homo sapiens (human): 8975Help
Entry
8975              CDS       T01001                                 

Gene name
USP13, ISOT3, IsoT-3
Definition
ubiquitin specific peptidase 13 (isopeptidase T-3) (EC:3.4.19.12)
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     8975 (USP13)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   8975 (USP13)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   8975 (USP13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3q26.2-q26.3
AA seq 863 aa AA seqDB search
MQRRGALFGMPGGSGGRKMAAGDIGELLVPHMPTIRVPRSGDRVYKNECAFSYDSPNSEG
GLYVCMNTFLAFGREHVERHFRKTGQSVYMHLKRHVREKVRGASGGALPKRRNSKIFLDL
DTDDDLNSDDYEYEDEAKLVIFPDHYEIALPNIEELPALVTIACDAVLSSKSPYRKQDPD
TWENELPVSKYANNLTQLDNGVRIPPSGWKCARCDLRENLWLNLTDGSVLCGKWFFDSSG
GNGHALEHYRDMGYPLAVKLGTITPDGADVYSFQEEEPVLDPHLAKHLAHFGIDMLHMHG
TENGLQDNDIKLRVSEWEVIQESGTKLKPMYGPGYTGLKNLGNSCYLSSVMQAIFSIPEF
QRAYVGNLPRIFDYSPLDPTQDFNTQMTKLGHGLLSGQYSKPPVKSELIEQVMKEEHKPQ
QNGISPRMFKAFVSKSHPEFSSNRQQDAQEFFLHLVNLVERNRIGSENPSDVFRFLVEER
IQCCQTRKVRYTERVDYLMQLPVAMEAATNKDELIAYELTRREAEANRRPLPELVRAKIP
FSACLQAFSEPENVDDFWSSALQAKSAGVKTSRFASFPEYLVVQIKKFTFGLDWVPKKFD
VSIDMPDLLDINHLRARGLQPGEEELPDISPPIVIPDDSKDRLMNQLIDPSDIDESSVMQ
LAEMGFPLEACRKAVYFTGNMGAEVAFNWIIVHMEEPDFAEPLTMPGYGGAASAGASVFG
ASGLDNQPPEEIVAIITSMGFQRNQAIQALRATNNNLERALDWIFSHPEFEEDSDFVIEM
ENNANANIISEAKPEGPRVKDGSGTYELFAFISHMGTSTMSGHYICHIKKEGRWVIYNDH
KVCASERPPKDLGYMYFYRRIPS
NT seq 2592 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgccggggcgccctgttcggcatgccgggcggcagcggaggcaggaagatggct
gcaggagacatcggcgagctgctagtgccccacatgcccacgatccgcgtgcccaggtcc
ggcgacagggtctacaagaacgagtgcgccttctcctacgactctcccaattctgaaggt
ggactctatgtatgcatgaatacatttttggcctttggaagggaacatgttgaaagacat
tttcgaaaaactggacagagtgtatacatgcacctgaaaagacatgtgcgagagaaggta
agaggggcgtctggtggagcgttaccaaaaaggaggaattccaagatttttttagatcta
gatactgatgacgatttaaatagcgacgattatgaatatgaagatgaagccaaacttgtt
atattcccagatcactatgaaatagcactaccaaatattgaggagttaccagccctggta
acaattgcttgtgatgcagttctcagctcaaaatctccatacagaaagcaggacccagac
acgtgggaaaatgaattgccagtatctaaatatgccaacaacctcacccagctggacaat
ggagtcaggattcctccaagtggttggaagtgtgccagatgcgacctgcgagaaaacctc
tggttgaatctgactgacggctctgtcctgtgtggaaagtggttctttgacagctctggg
ggcaacgggcatgcgctggagcattacagagacatgggctacccactagccgtgaaactg
ggaaccatcactcctgacggggcagatgtttattcttttcaagaagaagaacctgttttg
gatcctcatttggccaagcacttagcgcattttggaattgatatgcttcatatgcatggg
acagagaatgggctccaggacaatgacatcaagctgagggtcagtgagtgggaagtgatc
caggagtcgggcacgaaactgaagccaatgtatggtcctggctacacgggtctgaagaac
ctgggcaacagctgctatctcagctctgtcatgcaggccatcttcagcatcccagaattc
cagagagcgtatgtaggaaaccttcccagaatatttgactactcgcctttagatccaaca
caagatttcaacacacagatgactaagttaggacatggccttctctcaggccagtattca
aagcctccggtgaaatctgaactcattgaacaggtgatgaaggaggagcacaagccacag
cagaacgggatctctccgcgcatgtttaaggcctttgtaagcaagagccacccggaattc
tcctctaacaggcagcaagatgcccaggaattcttcttgcacctggtgaatctagtagag
aggaaccgcatcggctcagaaaacccaagcgatgtttttcgttttttggtggaagaacgc
attcagtgctgtcagacccggaaagtccgctacacggagagggtggattacctgatgcag
ttacctgtggccatggaggcggcaaccaacaaggatgaactgatcgcttatgaactaacg
agaagggaagcagaagcaaacagaagaccccttcctgagttggtacgtgccaagatacca
tttagtgcctgccttcaggccttctctgaaccagaaaatgttgatgatttctggagcagt
gccctacaagcaaagtctgcgggtgtgaaaacatctcgctttgcttcattccctgaatac
ttggtagtgcagataaagaagttcacttttggtcttgactgggttcccaaaaaatttgat
gtttctattgatatgccagacctacttgatatcaaccatctccgagccagggggttacag
ccaggagaggaagaacttccagacatcagcccccccatagtcattcctgatgactcaaaa
gatcgcctgatgaaccaattgatagacccatcagacatcgatgagtcatcagtgatgcag
ctggccgagatgggtttcccgctggaagcatgtcgcaaggctgtgtacttcactggaaat
atgggcgccgaggtggccttcaactggatcattgttcacatggaagagccagattttgct
gagccgctgaccatgcctggttatggaggggcagcttctgctggagcctctgtttttggt
gcttctggactggataaccaacctccagaggaaatcgtagctatcatcacctccatggga
tttcagcgaaatcaggctattcaggcactacgagcaacgaataataacctggaaagagca
ctggattggatctttagccaccctgagtttgaagaagacagtgattttgtgattgagatg
gagaataatgccaatgcaaacattatttctgaggccaagcccgaaggacctagagtcaag
gatggatctggaacatatgagctatttgcattcatcagtcacatgggaacatccacaatg
agtggtcattacatttgccatatcaaaaaggaaggaagatgggtgatttacaatgaccac
aaagtttgtgcctcagaaaggccccctaaagacctgggctacatgtacttttaccgcagg
ataccaagctaa

DBGET integrated database retrieval system