KEGG   Homo sapiens (human): 89780Help
Entry
89780             CDS       T01001                                 

Gene name
WNT3A
Definition
wingless-type MMTV integration site family, member 3A
Orthology
K00312  
wingless-type MMTV integration site family, member 3
Organism
hsa  Homo sapiens (human)
Pathway
Wnt signaling pathway
Hedgehog signaling pathway
Hippo signaling pathway
Signaling pathways regulating pluripotency of stem cells
Melanogenesis
HTLV-I infection
Pathways in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Basal cell carcinoma
Module
Wnt signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    89780 (WNT3A)
   04340 Hedgehog signaling pathway
    89780 (WNT3A)
   04390 Hippo signaling pathway
    89780 (WNT3A)
 Cellular Processes
  Cellular commiunity
   04550 Signaling pathways regulating pluripotency of stem cells
    89780 (WNT3A)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    89780 (WNT3A)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    89780 (WNT3A)
   05206 MicroRNAs in cancer
    89780 (WNT3A)
   05205 Proteoglycans in cancer
    89780 (WNT3A)
   05217 Basal cell carcinoma
    89780 (WNT3A)
  Infectious diseases
   05166 HTLV-I infection
    89780 (WNT3A)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Morphogens (General comment) Effective diffusion, tissue differentiation, development
  89780 (WNT3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q42
AA seq 352 aa AA seqDB search
MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVPKQLRFCRNYV
EIMPSVAEGIKIGIQECQHQFRGRRWNCTTVHDSLAIFGPVLDKATRESAFVHAIASAGV
AFAVTRSCAEGTAAICGCSSRHQGSPGKGWKWGGCSEDIEFGGMVSREFADARENRPDAR
SAMNRHNNEAGRQAIASHMHLKCKCHGLSGSCEVKTCWWSQPDFRAIGDFLKDKYDSASE
MVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEASPNFCEPNPETGSFGTRDRTCNVS
SHGIDGCDLLCCGRGHNARAERRREKCRCVFHWCCYVSCQECTRVYDVHTCK
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggccccactcggatacttcttactcctctgcagcctgaagcaggctctgggcagctac
ccgatctggtggtcgctggctgttgggccacagtattcctccctgggctcgcagcccatc
ctgtgtgccagcatcccgggcctggtccccaagcagctccgcttctgcaggaactacgtg
gagatcatgcccagcgtggccgagggcatcaagattggcatccaggagtgccagcaccag
ttccgcggccgccggtggaactgcaccaccgtccacgacagcctggccatcttcgggccc
gtgctggacaaagctaccagggagtcggcctttgtccacgccattgcctcagccggtgtg
gcctttgcagtgacacgctcatgtgcagaaggcacggccgccatctgtggctgcagcagc
cgccaccagggctcaccaggcaagggctggaagtggggtggctgtagcgaggacatcgag
tttggtgggatggtgtctcgggagttcgccgacgcccgggagaaccggccagatgcccgc
tcagccatgaaccgccacaacaacgaggctgggcgccaggccatcgccagccacatgcac
ctcaagtgcaagtgccacgggctgtcgggcagctgcgaggtgaagacatgctggtggtcg
caacccgacttccgcgccatcggtgacttcctcaaggacaagtacgacagcgcctcggag
atggtggtggagaagcaccgggagtcccgcggctgggtggagaccctgcggccgcgctac
acctacttcaaggtgcccacggagcgcgacctggtctactacgaggcctcgcccaacttc
tgcgagcccaaccctgagacgggctccttcggcacgcgcgaccgcacctgcaacgtcagc
tcgcacggcatcgacggctgcgacctgctgtgctgcggccgcggccacaacgcgcgagcg
gagcggcgccgggagaagtgccgctgcgtgttccactggtgctgctacgtcagctgccag
gagtgcacgcgcgtctacgacgtgcacacctgcaagtag

DBGET integrated database retrieval system