KEGG   Homo sapiens (human): 89822Help
Entry
89822             CDS       T01001                                 

Gene name
KCNK17, K2p17.1, TALK-2, TALK2, TASK-4, TASK4
Definition
(RefSeq) potassium two pore domain channel subfamily K member 17
  KO
K04925  
potassium channel subfamily K member 17
Organism
hsa  Homo sapiens (human)
Brite
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  K+ channel, KCNK, K2px.x
   89822 (KCNK17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6p21.1
AA seq 332 aa AA seqDB search
MYRPRARAAPEGRVRGCAVPSTVLLLLAYLAYLALGTGVFWTLEGRAAQDSSRSFQRDKW
ELLQNFTCLDRPALDSLIRDVVQAYKNGASLLSNTTSMGRWELVGSFFFSVSTITTIGYG
NLSPNTMAARLFCIFFALVGIPLNLVVLNRLGHLMQQGVNHWASRLGGTWQDPDKARWLA
GSGALLSGLLLFLLLPPLLFSHMEGWSYTEGFYFAFITLSTVGFGDYVIGMNPSQRYPLW
YKNMVSLWILFGMAWLALIIKLILSQLETPGRVCSCCHHSSKEDFKSQSWRQGPDREPES
HSPQQGCYPEGPMGIIQHLEPSAHAAGCGKDS
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgtaccgaccgcgagcccgggcggctcccgagggcagggtccggggctgcgcggtgccc
agcaccgtgctcctgctgctcgcctacctggcttacctggcgctgggcaccggcgtgttc
tggacgctggagggccgcgcggcgcaggactccagccgcagcttccagcgcgacaagtgg
gagctgttgcagaacttcacgtgtctggaccgcccggcgctggactcgctgatccgggat
gtcgtccaagcatacaaaaacggagccagcctcctcagcaacaccaccagcatggggcgc
tgggagctcgtgggctccttcttcttttctgtgtccaccatcaccaccattggctatggc
aacctgagccccaacacgatggctgcccgcctcttctgcatcttctttgcccttgtgggg
atcccactcaacctcgtggtgctcaaccgactggggcatctcatgcagcagggagtaaac
cactgggccagcaggctggggggcacctggcaggatcctgacaaggcgcggtggctggcg
ggctctggcgccctcctctcgggcctcctgctcttcctgctgctgccaccgctgctcttc
tcccacatggagggctggagctacacagagggcttctacttcgccttcatcaccctcagc
accgtgggcttcggcgactacgtgattggaatgaacccctcccagaggtacccactgtgg
tacaagaacatggtgtccctgtggatcctctttgggatggcatggctggccttgatcatc
aaactcatcctctcccagctggagacgccagggagggtatgttcctgctgccaccacagc
tctaaggaagacttcaagtcccaaagctggagacagggacctgaccgggagccagagtcc
cactccccacagcaaggatgctatccagagggacccatgggaatcatacagcatctggaa
ccttctgctcacgctgcaggctgtggcaaggacagctag

DBGET integrated database retrieval system