KEGG   Homo sapiens (human): 89845Help
Entry
89845             CDS       T01001                                 

Gene name
ABCC10, EST182763, MRP7, SIMRP7
Definition
ATP-binding cassette, sub-family C (CFTR/MRP), member 10
Orthology
K05674  
ATP-binding cassette, subfamily C (CFTR/MRP), member 10
Organism
hsa  Homo sapiens (human)
Pathway
ABC transporters
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:hsa02010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6p21.1
AA seq 1492 aa AA seqDB search
MERLLAQLCGSSAAWPLPLWEGDTTGHCFTQLVLSALPHALLAVLSACYLGTPRSPDYIL
PCSPGWRLRLAASFLLSVFPLLDLLPVALPPGAGPGPIGLEVLAGCVAAVAWISHSLALW
VLAHSPHGHSRGPLALALVALLPAPALVLTVLWHCQRGTLLPPLLPGPMARLCLLILQLA
ALLAYALGWAAPGGPREPWAQEPLLPEDQEPEVAEDGESWLSRFSYAWLAPLLARGACGE
LRQPQDICRLPHRLQPTYLARVFQAHWQEGARLWRALYGAFGRCYLALGLLKLVGTMLGF
SGPLLLSLLVGFLEEGQEPLSHGLLYALGLAGGAVLGAVLQNQYGYEVYKVTLQARGAVL
NILYCKALQLGPSRPPTGEALNLLGTDSERLLNFAGSFHEAWGLPLQLAITLYLLYQQVG
VAFVGGLILALLLVPVNKVIATRIMASNQEMLQHKDARVKLVTELLSGIRVIKFCGWEQA
LGARVEACRARELGRLRVIKYLDAACVYLWAALPVVISIVIFITYVLMGHQLTATKVFTA
LALVRMLILPLNNFPWVINGLLEAKVSLDRIQLFLDLPNHNPQAYYSPDPPAEPSTVLEL
HGALFSWDPVGTSLETFISHLEVKKGMLVGIVGKVGCGKSSLLAAIAGELHRLRGHVAVR
GLSKGFGLATQEPWIQFATIRDNILFGKTFDAQLYKEVLEACALNDDLSILPAGDQTEVG
EKGVTLSGGQRARIALARAVYQEKELYLLDDPLAAVDADVANHLLHRCILGMLSYTTRLL
CTHRTEYLERADAVLLMEAGRLIRAGPPSEILPLVQAVPKAWAENGQESDSATAQSVQNP
EKTKEGLEEEQSTSGRLLQEESKKEGAVALHVYQAYWKAVGQGLALAILFSLLLMQATRN
AADWWLSHWISQLKAENSSQEAQPSTSPASMGLFSPQLLLFSPGNLYIPVFPLPKAAPNG
SSDIRFYLTVYATIAGVNSLCTLLRAVLFAAGTLQAAATLHRRLLHRVLMAPVTFFNATP
TGRILNRFSSDVACADDSLPFILNILLANAAGLLGLLAVLGSGLPWLLLLLPPLSIMYYH
VQRHYRASSRELRRLGSLTLSPLYSHLADTLAGLSVLRATGATYRFEEENLRLLELNQRC
QFATSATMQWLDIRLQLMGAAVVSAIAGIALVQHQQGLANPGLVGLSLSYALSLTGLLSG
LVSSFTQTEAMLVSVERLEEYTCDLPQEPQGQPLQLGTGWLTQGGVEFQDVVLAYRPGLP
NALDGVTFCVQPGEKLGIVGRTGSGKSSLLLVLFRLLEPSSGRVLLDGVDTSQLELAQLR
SQLAIIPQEPFLFSGTVRENLDPQGLHKDRALWQALKQCHLSEVITSMGGLDGELGEGGR
SLSLGQRQLLCLARALLTDAKILCIDEATASVDQKTDQLLQQTICKRFANKTVLTIAHRL
NTILNSDRVLVLQAGRVVELDSPATLRNQPHSLFQQLLQSSQQGVPASLGGP
NT seq 4479 nt NT seq  +upstreamnt  +downstreamnt
atggaacgacttctggcccagctgtgcggcagcagcgcagcgtggccgctcccgctgtgg
gagggggacaccacaggccactgcttcacccagctggtgctcagcgccctgccccacgcg
ctcctcgccgtgctcagtgcctgttacttgggcaccccgaggagtccagattacatccta
ccctgcagtcctggatggcgcctccgacttgcagcttccttcctgctttccgtcttcccg
ctgctagaccttcttccagttgctttgccaccaggggcaggcccaggacccatagggcta
gaggtgttggcagggtgcgtggcagctgtggcctggatcagccacagcctggccctgtgg
gtgttggcacattcccctcatggccactcccggggtcccttggccttggccctggtagcc
ttgctgccagctccagccctagtgctgaccgtgttgtggcattgccagcgaggcacactt
ctgcccccacttctcccagggcccatggcccgcctatgcttgctcatcctgcagctggct
gcactcttggcctatgcactgggatgggcagctcctgggggaccacgagaaccctgggct
caggagcccctcctgcccgaggatcaagaacctgaggtggctgaagatggggagagttgg
ctgtcacgcttttcctatgcctggctggcacccttgctggcccgtggggcctgtggagag
ctccggcagcctcaggacatttgccgcctcccccacagactgcagccaacctacctggct
cgtgtcttccaggcacactggcaggagggggcacggctgtggagggccttgtatggggcc
tttggacggtgctatctggcacttggactgctgaagctggtggggaccatgttgggattc
tcagggcccctgttgctctccctactggtgggcttcctggaagaggggcaggagccacta
agccacggcctgctctatgctctggggctagccggtggggctgtgctgggtgctgtgctg
cagaatcagtatgggtatgaggtatataaggtaacacttcaggcacggggggctgtgctg
aacatcctgtactgcaaggctttacagctggggcccagccgccctcctactggggaggcc
ctgaacctactaggcactgactctgaacggctgcttaactttgctgggagcttccatgaa
gcctggggcctgcccctgcaactggccatcaccctctacctgctgtaccagcaggtaggc
gtggccttcgtgggtggtctcatcttggcactgctgctggtacccgtcaacaaagtgatt
gccacccgcatcatggccagcaaccaggaaatgctacagcacaaggatgcgcgggttaag
cttgtgacagagctgctgagtggcattcgggtcatcaagttctgcgggtgggagcaggca
ctgggagcccgagtagaggcctgccgggctcgagagctggggcgactccgggtcatcaaa
tacctggatgcggcctgtgtatacctgtgggctgccctaccggttgtcatctccatcgtt
atcttcatcacctatgtcctcatggggcaccagctcactgccaccaaggtgttcacggcc
ctggcactggtgcgaatgctcattcttcctctcaacaacttcccttgggtgatcaatggt
ctcctggaggccaaagtgtccttggaccggatccagcttttcctcgaccttccaaaccac
aacccccaggcctactacagcccagatccccctgcagagccatctacagtattggagctg
catggagccttgttctcctgggacccagttggaaccagcctggagaccttcatcagtcat
ctcgaagtgaaaaagggtatgctggtgggcatcgtggggaaggtcggctgtgggaagagc
tccctgctggctgccatcgctggagagctccacaggctgcgtgggcatgtggcagtgcgg
gggctgtccaagggctttggcctggccacccaggaaccctggatccagtttgccaccatc
cgagacaacatcctctttgggaagacatttgatgcacagctgtacaaggaggtgctagaa
gcctgcgccctcaatgatgacctcagtatcctgcctgctggagaccagacagaggtgggg
gagaagggtgtcacccttagcggaggacagcgtgcccggattgcccttgctcgtgctgtc
taccaggaaaaggagctctatctcctcgatgaccctctggccgctgtggatgcagatgtg
gccaaccacctgctgcacaggtgcatcctgggcatgctgagctacaccacacggctgctc
tgcacccaccgcactgagtacctggagagggctgacgcggtgctgctgatggaggccggg
cgcctcatccgggctggacctccctctgagattctgccactggtacaagctgtccccaaa
gcctgggctgagaatggacaagagtctgactcagccacagcccagtcagtacagaaccca
gagaaaacaaaggaggggctggaggaggagcagagcacatctggtcgcctgctgcaggaa
gaaagcaagaaggagggcgccgtggccttgcacgtgtaccaagcttactggaaggccgtg
ggccagggcttggccttagccatcctcttctctctgcttctcatgcaagccacgcggaac
gctgctgactggtggctctcccactggatctctcagctgaaggctgagaatagctcccag
gaggcgcaaccctccaccagcccagcttctatggggctcttctctccgcagctgctcctc
ttttcccctggaaacctctacatcccagtgttcccactgcccaaagctgcccccaatggc
tcctcagacatccgtttctacctcaccgtgtatgcgaccattgctggtgtaaattccctc
tgcacccttctccgggcagtgctctttgcagcaggcacccttcaagcagctgccactctg
catcgccgcctgctgcatcgagtccttatggcaccagtgactttcttcaatgccacaccc
acgggccggatcctaaaccgcttctcctctgatgtggcctgtgcggatgacagcctgccc
ttcatcctcaacatcctcctggccaacgcggcaggcctgctggggctcctggccgtgctg
ggctctggcctgccctggctgctgctcctgctgccgcctttgagcatcatgtactatcac
gtgcagcgccactacagggcctcctcacgggagctgcggcgcctgggcagcctcaccctg
tctccactgtatagccatctggccgataccttggctggcctctctgtgctccgggccaca
ggggccacctacaggtttgaggaggagaacctgcgactccttgagctaaaccagaggtgc
cagtttgccaccagtgccacaatgcagtggctggacattcggctacagctcatgggggcg
gcagtggtcagcgctatcgcaggcatcgctctggtgcagcaccagcagggcctcgctaac
ccagggctggtgggcttgtcgctgtcttatgccctgtccctgacgggcctgctctcgggc
ctggtgagcagcttcacacagacagaggccatgctggtgagcgtcgagcggctggaagag
tacacctgtgacctgccccaggaaccccagggccagccactgcagctgggcaccggctgg
ctgacccaggggggcgtggagttccaggacgtggtgttggcgtaccggccagggctgccg
aatgccctggatggagtgaccttctgcgtgcagcctggagagaagttgggcatcgtgggc
cgcacaggctccggcaagtcttccctgttgttggtgctcttccggctgctagagcccagt
tcagggcgagtgctgctggacggcgtggacaccagccagctggagctggcccagctcaga
tcccagttggctatcatcccccaggagccctttttgttcagtgggactgttcgggaaaac
ctggacccccagggcctacataaggacagggccttgtggcaggccctgaagcagtgccac
ctgagtgaggtgattacatccatgggtggtctggatggtgagctgggtgaggggggccgg
agcttatctcttgggcagaggcagctgttgtgtttggccagggctctcctcacagatgcc
aagatcctgtgtatcgatgaggccacagcaagtgtggaccagaagacagaccagctgctc
cagcagaccatctgcaaacgctttgccaacaagacagtgctgaccattgcccataggctc
aacacgatcctgaactcagaccgggtgctggtgctacaagcggggagagtggtagagctg
gactccccggccaccctgcgcaaccagccccactccctgttccagcagctgctgcagagc
agccagcagggagtccctgcctcactcggaggtccctga

DBGET integrated database retrieval system