KEGG   Homo sapiens (human): 89846Help
Entry
89846             CDS       T01001                                 

Gene name
FGD3, ZFYVE5
Definition
FYVE, RhoGEF and PH domain containing 3
Orthology
K05722  
FYVE, RhoGEF and PH domain containing 3
Organism
hsa  Homo sapiens (human)
Pathway
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    89846 (FGD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9
AA seq 725 aa AA seqDB search
MESGRGSSTPPGPIAALGMPDTGPGSSSLGKLQALPVGPRAHCGDPVSLAAAGDGSPDIG
PTGELSGSLKIPNRDSGIDSPSSSVAGENFPCEEGLEAGPSPTVLGAHAEMALDSQVPKV
TPQEEADSDVGEEPDSENTPQKADKDAGLAQHSGPQKLLHIAQELLHTEETYVKRLHLLD
QVFCTRLTDAGIPPEVIMGIFSNISSIHRFHGQFLLPELKTRITEEWDTNPRLGDILQKL
APFLKMYGEYVKNFDRAVGLVSTWTQRSPLFKDVVHSIQKQEVCGNLTLQHHMLEPVQRV
PRYELLLKDYLKRLPQDAPDRKDAERSLELISTAANHSNAAIRKVEKMHKLLEVYEQLGG
EEDIVNPANELIKEGQIQKLSAKNGTPQDRHLFLFNSMILYCVPKLRLMGQKFSVREKMD
ISGLQVQDIVKPNTAHTFIITGRKRSLELQTRTEEEKKEWIQIIQATIEKHKQNSETFKA
FGGAFSQDEDPSLSPDMPITSTSPVEPVVTTEGSSGAAGLEPRKLSSKTRRDKEKQSCKS
CGETFNSITKRRHHCKLCGAVICGKCSEFKAENSRQSRVCRDCFLTQPVAPESTEKTPTA
DPQPSLLCGPLRLSESGETWSEVWAAIPMSDPQVLHLQGGSQDGRLPRTIPLPSCKLSVP
DPEERLDSGHVWKLQWAKQSWYLSASSAELQQQWLETLSTAAHGDTAQDSPGALQLQVPM
GAAAP
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atggagtcaggcagggggtcctcaacccctccaggacccattgctgccctagggatgcca
gacactgggcctggcagttcctccctagggaagcttcaggcgctccctgttgggcccaga
gcccactgtggggaccctgtcagcctggctgcagcaggggacggctctccagacataggc
cccacgggagagctgagtggtagcttaaagatccccaaccgggacagcgggatcgacagt
ccctcctccagtgtggctggagagaactttccctgcgaggagggcttggaggctggccca
agccccactgtactgggggcgcacgcagagatggccctggacagccaggtcccgaaggtc
accccccaggaggaggcggacagcgacgtgggtgaggaacctgactctgagaacaccccc
cagaaggctgacaaggatgccggcctggcccagcactctggcccccagaagcttctccac
attgcccaggagctcctgcacaccgaggagacctatgtgaagcggctgcacctgctggac
caggttttctgcaccaggctgacggatgcggggatccctccagaagtcatcatgggcata
ttctctaacatctcctccatccaccgcttccacgggcagttcctgctgccggagctgaag
acgcggatcacggaggagtgggacacaaacccacggctcggggacatcctgcagaagctg
gccccattcctgaagatgtacggcgagtatgtcaagaactttgaccgagccgtagggctg
gtgagcacgtggacccagcgctccccactgtttaaagacgtcgtccacagcatccagaag
caggaggtatgcgggaacctgacgctgcagcaccacatgctggagcccgtgcagagggtc
ccccggtacgagctgctgctcaaggactatctgaagaggctcccgcaggacgccccagac
cggaaggatgcggagaggtccttggagctcatctccacagccgccaaccactccaatgct
gccattcggaaagtggagaaaatgcacaagctcttggaggtgtacgagcagctgggtggg
gaagaagacattgtcaacccggccaatgaactgatcaaggagggccaaatccagaaactg
tcagccaagaacggcaccccccaggaccgccacctcttcctgttcaacagcatgatcctt
tactgtgtgcccaagctgcggctcatgggccagaagttcagcgtccgggagaagatggac
atctcaggcctccaggtgcaggatatcgtcaagccaaacacagcacatacattcatcata
acaggaagaaaaaggtccctggagctgcagacgcggacagaggaagagaagaaagaatgg
attcagatcatccaggccaccatcgagaagcacaaacagaacagcgaaaccttcaaggct
tttggtggcgccttcagccaggatgaggaccccagcctctctccagacatgcctatcacg
agcaccagccctgtggagcctgtggtgaccaccgaaggcagttcgggtgcagcagggctc
gagcccagaaaactatcctctaagaccagacgtgacaaggagaagcagagctgtaagagc
tgtggtgagaccttcaactccatcaccaagaggaggcatcactgcaagctgtgtggggcg
gtcatctgtgggaagtgctccgagttcaaggccgagaacagccggcagagccgtgtctgc
agagattgtttcctgacacagccagtggcccctgagagcacagagaagacacccactgca
gacccccagcccagcctgctctgcggccccctgcggctgtcagagagcggtgagacctgg
agcgaggtgtgggccgccatccccatgtcagatccccaggtgctgcacctgcagggaggc
agccaggacggccggctgccccgcaccatccctctccccagctgcaaactgagtgtgccg
gaccctgaggagaggctggactcggggcatgtgtggaagctgcagtgggccaagcagtcc
tggtacctgagcgcctcctccgcagagctgcagcagcagtggctggaaaccctaagcact
gctgcccatggggacacggcccaggacagcccgggggccctgcagcttcaggtccctatg
ggcgcagctgctccgtga

DBGET integrated database retrieval system