KEGG   Homo sapiens (human): 89849Help
Entry
89849             CDS       T01001                                 

Gene name
ATG16L2, ATG16B, WDR80
Definition
(RefSeq) autophagy related 16 like 2
  KO
K17890  
autophagy-related protein 16, animal type
Organism
hsa  Homo sapiens (human)
Pathway
Regulation of autophagy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    89849 (ATG16L2)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    89849 (ATG16L2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q13.4
AA seq 619 aa AA seqDB search
MAGPGVPGAPAARWKRHIVRQLRLRDRTQKALFLELVPAYNHLLEKAELLDKFSKKLQPE
PNSVTPTTHQGPWEESELDSDQVPSLVALRVKWQEEEEGLRLVCGEMAYQVVEKGAALGT
LESELQQRQSRLAALEARVAQLREARAQQAQQVEEWRAQNAVQRAAYEALRAHVGLREAA
LRRLQEEARDLLERLVQRKARAAAERNLRNERRERAKQARVSQELKKAAKRTVSISEGPD
TLGDGMRERRETLALAPEPEPLEKEACEKWKRPFRSASATSLTLSHCVDVVKGLLDFKKR
RGHSIGGAPEQRYQIIPVCVAARLPTRAQDVLDAHLSEVNAVRFGPNSSLLATGGADRLI
HLWNVVGSRLEANQTLEGAGGSITSVDFDPSGYQVLAATYNQAAQLWKVGEAQSKETLSG
HKDKVTAAKFKLTRHQAVTGSRDRTVKEWDLGRAYCSRTINVLSYCNDVVCGDHIIISGH
NDQKIRFWDSRGPHCTQVIPVQGRVTSLSLSHDQLHLLSCSRDNTLKVIDLRVSNIRQVF
RADGFKCGSDWTKAVFSPDRSYALAGSCDGALYIWDVDTGKLESRLQGPHCAAVNAVAWC
YSGSHMVSVDQGRKVVLWQ
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atggcggggccgggcgtccccggtgcccccgcagcgcgctggaaacgccacatcgtgcgg
cagctgcggcttcgggaccgtacgcaaaaggcgcttttcctggagctggtgccggcctat
aaccatctcttagagaaggctgagctgctggacaagttctcaaagaagctgcagccggag
ccaaacagtgtcactcccaccacccaccagggcccctgggaggagtcagagcttgactca
gaccaagtcccatcactggtcgcactgagggtgaagtggcaggaggaggaggaggggctc
cggctggtctgtggtgagatggcctaccaggtggtggagaagggcgcggccctgggcacg
ctggagtcggagctgcagcagaggcaaagcaggctggcagccctggaggcccgcgtggcg
cagctgcgagaggcgcgggcgcagcaggcccagcaggtggaggagtggcgggcgcagaat
gcggtgcagcgggcagcctacgaggcgctgcgcgcgcacgtcgggctccgggaggcggca
ctgcgcaggctccaggaagaggcgcgcgacctgctggagaggctcgtgcagcgcaaggcg
cgcgccgcggccgagcgcaacctgcgcaacgagcgccgggagcgggccaagcaggcgcgg
gtgtcccaggagctgaagaaggctgccaagcggaccgtgagcatcagcgagggcccggac
accctaggcgatgggatgagggagagaagggagactctggctctggcccctgagccagag
cccctggagaaggaagcttgtgagaagtggaagaggcccttcaggtctgcctcagccacc
tccctgacgctgtcccactgtgtggatgtggtgaaggggcttctggattttaagaagagg
agaggtcactcaattgggggagcccctgagcagcgataccagatcatccctgtgtgtgtg
gctgcccgacttcctacccgggctcaggatgtgctggatgcccacctctctgaggtcaat
gctgttcgttttggccccaacagcagcctcctggccactggaggggctgaccgcctgatc
cacctctggaatgttgtgggaagtcgcctggaggccaaccagaccctggagggagctggt
ggcagcatcaccagtgtggactttgacccctcgggctaccaggttttagcagcaacttac
aaccaggctgcccagctctggaaggtgggggaggcacagtccaaggagacactgtctgga
cacaaggataaggtgacagctgccaaattcaagctaacgaggcaccaggcagtgactggg
agccgcgaccggacagtgaaggagtgggacctcggccgtgcctattgctccaggaccatc
aatgtcctttcctactgtaatgacgtggtgtgtggggaccatatcatcattagtggccac
aatgaccagaagatccggttctgggacagcagggggccccactgcacccaggtcatccct
gtgcagggccgggtcacctccctgagcctcagccacgaccaactgcacctgctcagctgt
tcccgagacaacacactcaaggtcatcgacctgcgtgtcagcaacatccgccaggtgttc
agggccgatggcttcaagtgtggttctgactggaccaaagctgtgttcagcccggacaga
agctatgcactggcaggctcctgtgatggggccctttacatctgggatgtggacaccggg
aaactggagagcagactacagggaccccattgcgctgccgtcaacgccgtggcctggtgc
tactccgggagccacatggtgagcgtggaccagggcaggaaggttgtgctctggcagtag

DBGET integrated database retrieval system