KEGG   Homo sapiens (human): 89853Help
Entry
89853             CDS       T01001                                 

Gene name
MVB12B, C9orf28, FAM125B
Definition
multivesicular body subunit 12B
Orthology
K12186  
ESCRT-I complex subunit MVB12
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Module
ESCRT-I complex
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:hsa04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9q33.3
AA seq 221 aa AA seqDB search
MRSCFCVRRSRDPPPPQPPPPPPQRGTDQSTMPEVKDLSEALPETSMDPITGVGVVASRN
RAPTGYDVVAQTADGVDADLWKDGLFKSKVTRYLCFTRSFSKENSHLGNVLVDMKLIDIK
DTLPVGFIPIQETVDTQEVAFRKKRLCIKFIPRDSTEAAICDIRIMGRTKQAPPQYTFIG
ELNSMGIWYRMGRVPRNHDSSQPTTPSQSSAASTPAPNLPR
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgagaagctgcttctgcgtgagacggagccgggacccgccgccgccgcagccaccgccg
ccgccgccccagcggggaacagaccagtccaccatgcctgaagtcaaagacctctcagaa
gccttgccagaaacgtcaatggatcccatcacgggagtcggggtggtggcttctcggaac
cgagccccgacaggctatgacgtagttgcacagacagcagatggtgtggatgctgacctc
tggaaagacggcttatttaaatccaaggttaccagatacctgtgtttcacaagatcattt
tccaaagaaaatagtcatctggggaacgtgttagtagatatgaagctcattgacatcaag
gacacactgcctgtgggcttcatcccaattcaggagacggtggacacacaggaagtggct
tttaggaagaagaggctgtgcattaaatttattccacgggattcaacggaagctgcgatt
tgtgacattcggatcatgggccggaccaagcaggccccgcctcagtacacgtttattggg
gaactgaacagcatggggatctggtatcgaatgggcagagtaccaagaaatcatgactca
tctcaacccacaacgccttcccagtcatcagctgcctccaccccagcccccaaccttccc
aggtga

DBGET integrated database retrieval system