KEGG   Homo sapiens (human): 8986Help
Entry
8986              CDS       T01001                                 

Gene name
RPS6KA4, MSK2, RSK-B
Definition
ribosomal protein S6 kinase, 90kDa, polypeptide 4 (EC:2.7.11.1)
Orthology
K16510  
ribosomal protein S6 kinase alpha-4 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
TNF signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    8986 (RPS6KA4)
   04668 TNF signaling pathway
    8986 (RPS6KA4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     8986 (RPS6KA4)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: AGC group
  RSK family [Table]
   8986 (RPS6KA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q11-q13
AA seq 766 aa AA seqDB search
MGDEDDDESCAVELRITEANLTGHEEKVSVENFELLKVLGTGAYGKVFLVRKAGGHDAGK
LYAMKVLRKAALVQRAKTQEHTRTERSVLELVRQAPFLVTLHYAFQTDAKLHLILDYVSG
GEMFTHLYQRQYFKEAEVRVYGGEIVLALEHLHKLGIIYRDLKLENVLLDSEGHIVLTDF
GLSKEFLTEEKERTFSFCGTIEYMAPEIIRSKTGHGKAVDWWSLGILLFELLTGASPFTL
EGERNTQAEVSRRILKCSPPFPPRIGPVAQDLLQRLLCKDPKKRLGAGPQGAQEVRNHPF
FQGLDWVALAARKIPAPFRPQIRSELDVGNFAEEFTRLEPVYSPPGSPPPGDPRIFQGYS
FVAPSILFDHNNAVMTDGLEAPGAGDRPGRAAVARSAMMQQYELDLREPALGQGSFSVCR
RCRQRQSGQEFAVKILSRRLEANTQREVAALRLCQSHPNVVNLHEVHHDQLHTYLVLELL
RGGELLEHIRKKRHFSESEASQILRSLVSAVSFMHEEAGVVHRDLKPENILYADDTPGAP
VKIIDFGFARLRPQSPGVPMQTPCFTLQYAAPELLAQQGYDESCDLWSLGVILYMMLSGQ
VPFQGASGQGGQSQAAEIMCKIREGRFSLDGEAWQGVSEEAKELVRGLLTVDPAKRLKLE
GLRGSSWLQDGSARSSPPLRTPDVLESSGPAVRSGLNATFMAFNRGKREGFFLKSVENAP
LAKRRKQKLRSATASRRGSPAPANPGRAPVASKGAPRRANGPLPPS
NT seq 2301 nt NT seq  +upstreamnt  +downstreamnt
atgggggacgaggacgacgatgagagctgcgccgtggagctgcggatcacagaagccaac
ctgaccgggcacgaggagaaggtgagcgtggagaacttcgagctgctcaaggtgctgggc
acgggagcctacggcaaggtgttcctggtgcggaaggcgggcgggcacgacgcggggaag
ctgtacgccatgaaggtgctgcgcaaggcggcgctggtgcagcgcgccaagacgcaagag
cacacgcgcaccgagcgctcggtgctggagctggtgcgccaggcgcccttcctggtcacg
ctgcactacgctttccagacggatgccaagctgcacctcatcctggactatgtgagcggc
ggggagatgttcacccacctctaccagcgccagtacttcaaggaggctgaggtgcgcgtg
tatgggggtgagatcgtgctggccctggaacacctgcacaagctcggcatcatttaccga
gacctgaaactggagaatgtgctgctggactccgagggccacattgtcctcacggacttc
gggctgagcaaggagttcctgacggaggagaaagagcggaccttctccttctgtggcacc
atcgagtacatggcccccgaaatcatccgtagcaagacggggcatggcaaggctgtggac
tggtggagcctgggcatcttgctcttcgagctgctgacgggggcctcgcccttcaccctg
gagggcgagaggaacacgcaggctgaggtgtctcgacggatcctgaagtgctcccctccc
ttcccccctcggatcgggcccgtggcgcaggacctgctgcagcggctgctttgtaaggat
cctaagaagcgattgggcgcggggccccagggggcacaagaagtccggaaccatcccttc
ttccagggcctcgattgggtggctctggctgccaggaagattccagccccattccggccc
caaatccgctcagagctggatgtgggcaactttgcggaggaattcactcggctggagcct
gtctactcaccccctggcagccccccacctggggacccccgaatctttcagggatactcc
tttgtggcaccctccattctctttgaccacaacaacgcggtgatgaccgatgggctggaa
gcgcctggtgctggagaccggccaggtcgggcagcggtggccaggagcgctatgatgcag
cagtacgagctggacctgcgggagcctgcgctgggccagggcagcttttctgtgtgtcgc
cgctgccgccagcgccagagcggccaggagttcgcagtcaagatcctcagtcgcaggctg
gaggcgaacacgcagcgcgaagtggctgccctgcgcctgtgccagtcacaccccaacgtg
gtgaatctgcacgaggtgcatcacgaccagctgcacacgtacctggtcctggagctgctg
cggggcggggagctgctggagcacatccgcaagaagcggcacttcagcgagtcggaagca
agccagatcctgcgcagcctcgtgtcggccgtgagcttcatgcacgaggaggcgggcgtg
gtgcaccgcgacctcaagccggagaacatcctgtacgccgacgacacgcccggggccccg
gtgaaaatcatcgacttcgggttcgcgcggttgcggccgcagagtcccggggtgcccatg
cagacgccctgcttcacgctgcagtacgctgcccccgagctgctggcgcagcagggctac
gacgagtcctgcgacctctggagcctgggcgtcattctgtacatgatgctgtcggggcag
gtccccttccagggggcctctggccagggcgggcagagccaggcggccgagatcatgtgc
aaaatccgcgaggggcgcttctcccttgacggggaggcctggcagggtgtatccgaggaa
gccaaggagctggtccgagggctcctgaccgtggaccccgccaagcggctgaagctcgag
ggactgcggggcagctcgtggctgcaggacggcagcgcgcgctcctcgcccccgctccgg
acgcccgacgtgctcgagtcctctgggcccgcagtgcgctcgggtctcaacgccaccttc
atggcattcaaccggggcaagcgggagggcttcttcctgaagagcgtggagaatgcaccc
ctggccaagcggcggaagcagaagctgcggagcgccaccgcctcccgccggggctcccct
gcaccagccaacccgggccgagcccccgtcgcctccaaaggggccccccgccgagccaac
ggccccctgcccccctcctaa

DBGET integrated database retrieval system