KEGG   Homo sapiens (human): 8989Help
Entry
8989              CDS       T01001                                 

Gene name
TRPA1, ANKTM1, FEPS, FEPS1
Definition
(RefSeq) transient receptor potential cation channel subfamily A member 1
  KO
K04984  transient receptor potential cation channel subfamily A member 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04750  Inflammatory mediator regulation of TRP channels
Disease
H01391  Familial episodic pain syndrome (FEPS)
Drug target
Allyl isothiocyanate: D02818
Menthol (DG01385): D00064 D04849 D04918
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    8989 (TRPA1)
Ion channels [BR:hsa04040]
 Related to voltage-gated cation channels
  Transient receptor potential family, TRPA (ANKTM1)
   8989 (TRPA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank Ank_4 Ank_3 Ank_5 Ion_trans
Motif
Other DBs
NCBI-GeneID: 8989
NCBI-ProteinID: NP_015628
OMIM: 604775
HGNC: 497
Ensembl: ENSG00000104321
Vega: OTTHUMG00000164516
Pharos: O75762(Tclin)
UniProt: O75762
Position
8q21.11
AA seq 1119 aa AA seqDB search
MKRSLRKMWRPGEKKEPQGVVYEDVPDDTEDFKESLKVVFEGSAYGLQNFNKQKKLKRCD
DMDTFFLHYAAAEGQIELMEKITRDSSLEVLHEMDDYGNTPLHCAVEKNQIESVKFLLSR
GANPNLRNFNMMAPLHIAVQGMNNEVMKVLLEHRTIDVNLEGENGNTAVIIACTTNNSEA
LQILLKKGAKPCKSNKWGCFPIHQAAFSGSKECMEIILRFGEEHGYSRQLHINFMNNGKA
TPLHLAVQNGDLEMIKMCLDNGAQIDPVEKGRCTAIHFAATQGATEIVKLMISSYSGSVD
IVNTTDGCHETMLHRASLFDHHELADYLISVGADINKIDSEGRSPLILATASASWNIVNL
LLSKGAQVDIKDNFGRNFLHLTVQQPYGLKNLRPEFMQMQQIKELVMDEDNDGCTPLHYA
CRQGGPGSVNNLLGFNVSIHSKSKDKKSPLHFAASYGRINTCQRLLQDISDTRLLNEGDL
HGMTPLHLAAKNGHDKVVQLLLKKGALFLSDHNGWTALHHASMGGYTQTMKVILDTNLKC
TDRLDEDGNTALHFAAREGHAKAVALLLSHNADIVLNKQQASFLHLALHNKRKEVVLTII
RSKRWDECLKIFSHNSPGNKCPITEMIEYLPECMKVLLDFCMLHSTEDKSCRDYYIEYNF
KYLQCPLEFTKKTPTQDVIYEPLTALNAMVQNNRIELLNHPVCKEYLLMKWLAYGFRAHM
MNLGSYCLGLIPMTILVVNIKPGMAFNSTGIINETSDHSEILDTTNSYLIKTCMILVFLS
SIFGYCKEAGQIFQQKRNYFMDISNVLEWIIYTTGIIFVLPLFVEIPAHLQWQCGAIAVY
FYWMNFLLYLQRFENCGIFIVMLEVILKTLLRSTVVFIFLLLAFGLSFYILLNLQDPFSS
PLLSIIQTFSMMLGDINYRESFLEPYLRNELAHPVLSFAQLVSFTIFVPIVLMNLLIGLA
VGDIAEVQKHASLKRIAMQVELHTSLEKKLPLWFLRKVDQKSTIVYPNKPRSGGMLFHIF
CFLFCTGEIRQEIPNADKSLEMEILKQKYRLKDLTFLLEKQHELIKLIIQKMEIISETED
DDSHCSFQDRFKKEQMEQRNSRWNTVLRAVKAKTHHLEP
NT seq 3360 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcagcctgaggaagatgtggcgccctggagaaaagaaggagccccagggcgtt
gtctatgaggatgtgccggacgacacggaggatttcaaggaatcgcttaaggtggttttt
gaaggaagtgcatatggattacaaaactttaataagcaaaagaaattaaaaagatgtgac
gatatggacaccttcttcttgcattatgctgcagcagaaggccaaattgagctaatggag
aagatcaccagagattcctctttggaagtgctgcatgaaatggatgattatggaaatacc
cctctgcattgtgctgtagaaaaaaaccaaattgaaagcgttaagtttcttctcagcaga
ggagcaaacccaaatctccgaaacttcaacatgatggctcctctccacatagctgtgcag
ggcatgaataatgaggtgatgaaggtcttgcttgagcatagaactattgatgttaatttg
gaaggagaaaatggaaacacagctgtgatcattgcgtgcaccacaaataatagcgaagca
ttgcagattttgcttaaaaaaggagctaagccatgtaaatcaaataaatggggatgtttc
cctattcaccaagctgcattttcaggttccaaagaatgcatggaaataatactaaggttt
ggtgaagagcatgggtacagtagacagttgcacattaactttatgaataatgggaaagcc
acccctctccacctggctgtgcaaaatggtgacttggaaatgatcaaaatgtgcctggac
aatggtgcacaaatagacccagtggagaagggaaggtgcacagccattcattttgctgcc
acccagggagccactgagattgttaaactgatgatatcgtcctattctggtagcgtggat
attgttaacacaaccgatggatgtcatgagaccatgcttcacagagcttcattgtttgat
caccatgagctagcagactatttaatttcagtgggagcagatattaataagatcgattct
gaaggacgctctccacttatattagcaactgcttctgcatcttggaatattgtaaatttg
ctactctctaaaggtgcccaagtagacataaaagataattttggacgtaattttctgcat
ttaactgtacagcaaccttatggattaaaaaatctgcgacctgaatttatgcagatgcaa
cagatcaaagagctggtaatggatgaagacaacgatgggtgtactcctctacattatgca
tgtagacaggggggccctggttctgtaaataacctacttggctttaatgtgtccattcat
tccaaaagcaaagataagaaatcacctctgcattttgcagccagttatgggcgtatcaat
acctgtcagaggctcctacaagacataagtgatacgaggcttctgaatgaaggtgacctt
catggaatgactcctctccatctggcagcaaagaatggacatgataaagtagttcagctt
cttctgaaaaaaggtgcattgtttctcagtgaccacaatggctggacagctttgcatcat
gcgtccatgggcgggtacactcagaccatgaaggtcattcttgatactaatttgaagtgc
acagatcgcctggatgaagacgggaacactgcacttcactttgctgcaagggaaggccac
gccaaagccgttgcgcttcttctgagccacaatgctgacatagtcctgaacaagcagcag
gcctcctttttgcaccttgcacttcacaataagaggaaggaggttgttcttacgatcatc
aggagcaaaagatgggatgaatgtcttaagattttcagtcataattctccaggcaataaa
tgtccaattacagaaatgatagaatacctccctgaatgcatgaaggtacttttagatttc
tgcatgttgcattccacagaagacaagtcctgccgagactattatatcgagtataatttc
aaatatcttcaatgtccattagaattcaccaaaaaaacacctacacaggatgttatatat
gaaccgcttacagccctcaacgcaatggtacaaaataaccgcatagagcttctcaatcat
cctgtgtgtaaagaatatttactcatgaaatggttggcttatggatttagagctcatatg
atgaatttaggatcttactgtcttggtctcatacctatgaccattctcgttgtcaatata
aaaccaggaatggctttcaactcaactggcatcatcaatgaaactagtgatcattcagaa
atactagataccacgaattcatatctaataaaaacttgtatgattttagtgtttttatca
agtatatttgggtattgcaaagaagcggggcaaattttccaacagaaaaggaattatttt
atggatataagcaatgttcttgaatggattatctacacgacgggcatcatttttgtgctg
cccttgtttgttgaaataccagctcatctgcagtggcaatgtggagcaattgctgtttac
ttctattggatgaatttcttattgtatcttcaaagatttgaaaattgtggaatttttatt
gttatgttggaggtaattttgaaaactttgttgaggtctacagttgtatttatcttcctt
cttctggcttttggactcagcttttacatcctcctgaatttacaggatcccttcagctct
ccattgctttctataatccagaccttcagcatgatgctaggagatatcaattatcgagag
tccttcctagaaccatatctgagaaatgaattggcacatccagttctgtcctttgcacaa
cttgtttccttcacaatatttgtcccaattgtcctcatgaatttacttattggtttggca
gttggcgacattgctgaggtccagaaacatgcatcattgaagaggatagctatgcaggtg
gaacttcataccagcttagagaagaagctgccactttggtttctacgcaaagtggatcag
aaatccaccatcgtgtatcccaacaaacccagatctggtgggatgttattccatatattc
tgttttttattttgcactggggaaataagacaagaaataccaaatgctgataaatcttta
gaaatggaaatattaaagcagaaataccggctgaaggatcttacttttctcctggaaaaa
cagcatgagctcattaaactgatcattcagaagatggagatcatctctgagacagaggat
gatgatagccattgttcttttcaagacaggtttaagaaagagcagatggaacaaaggaat
agcagatggaatactgtgttgagagcagtcaaggcaaaaacacaccatcttgagccttag

DBGET integrated database retrieval system