KEGG   Homo sapiens (human): 8989Help
Entry
8989              CDS       T01001                                 

Gene name
TRPA1, ANKTM1, FEPS
Definition
(RefSeq) transient receptor potential cation channel subfamily A member 1
  KO
K04984  
transient receptor potential cation channel subfamily A member 1
Organism
hsa  Homo sapiens (human)
Pathway
Inflammatory mediator regulation of TRP channels
Disease
H01391  
Familial episodic pain syndrome (FEPS)
Drug target
Camphora [DG:DG00240]: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    8989 (TRPA1)
Ion channels [BR:hsa04040]
 Related to voltage-gated cation channels
  Transient receptor potential family, TRPA (ANKTM1)
   8989 (TRPA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8q13
AA seq 1119 aa AA seqDB search
MKRSLRKMWRPGEKKEPQGVVYEDVPDDTEDFKESLKVVFEGSAYGLQNFNKQKKLKRCD
DMDTFFLHYAAAEGQIELMEKITRDSSLEVLHEMDDYGNTPLHCAVEKNQIESVKFLLSR
GANPNLRNFNMMAPLHIAVQGMNNEVMKVLLEHRTIDVNLEGENGNTAVIIACTTNNSEA
LQILLKKGAKPCKSNKWGCFPIHQAAFSGSKECMEIILRFGEEHGYSRQLHINFMNNGKA
TPLHLAVQNGDLEMIKMCLDNGAQIDPVEKGRCTAIHFAATQGATEIVKLMISSYSGSVD
IVNTTDGCHETMLHRASLFDHHELADYLISVGADINKIDSEGRSPLILATASASWNIVNL
LLSKGAQVDIKDNFGRNFLHLTVQQPYGLKNLRPEFMQMQQIKELVMDEDNDGCTPLHYA
CRQGGPGSVNNLLGFNVSIHSKSKDKKSPLHFAASYGRINTCQRLLQDISDTRLLNEGDL
HGMTPLHLAAKNGHDKVVQLLLKKGALFLSDHNGWTALHHASMGGYTQTMKVILDTNLKC
TDRLDEDGNTALHFAAREGHAKAVALLLSHNADIVLNKQQASFLHLALHNKRKEVVLTII
RSKRWDECLKIFSHNSPGNKCPITEMIEYLPECMKVLLDFCMLHSTEDKSCRDYYIEYNF
KYLQCPLEFTKKTPTQDVIYEPLTALNAMVQNNRIELLNHPVCKEYLLMKWLAYGFRAHM
MNLGSYCLGLIPMTILVVNIKPGMAFNSTGIINETSDHSEILDTTNSYLIKTCMILVFLS
SIFGYCKEAGQIFQQKRNYFMDISNVLEWIIYTTGIIFVLPLFVEIPAHLQWQCGAIAVY
FYWMNFLLYLQRFENCGIFIVMLEVILKTLLRSTVVFIFLLLAFGLSFYILLNLQDPFSS
PLLSIIQTFSMMLGDINYRESFLEPYLRNELAHPVLSFAQLVSFTIFVPIVLMNLLIGLA
VGDIAEVQKHASLKRIAMQVELHTSLEKKLPLWFLRKVDQKSTIVYPNKPRSGGMLFHIF
CFLFCTGEIRQEIPNADKSLEMEILKQKYRLKDLTFLLEKQHELIKLIIQKMEIISETED
DDSHCSFQDRFKKEQMEQRNSRWNTVLRAVKAKTHHLEP
NT seq 3360 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcagcctgaggaagatgtggcgccctggagaaaagaaggagccccagggcgtt
gtctatgaggatgtgccggacgacacggaggatttcaaggaatcgcttaaggtggttttt
gaaggaagtgcatatggattacaaaactttaataagcaaaagaaattaaaaagatgtgac
gatatggacaccttcttcttgcattatgctgcagcagaaggccaaattgagctaatggag
aagatcaccagagattcctctttggaagtgctgcatgaaatggatgattatggaaatacc
cctctgcattgtgctgtagaaaaaaaccaaattgaaagcgttaagtttcttctcagcaga
ggagcaaacccaaatctccgaaacttcaacatgatggctcctctccacatagctgtgcag
ggcatgaataatgaggtgatgaaggtcttgcttgagcatagaactattgatgttaatttg
gaaggagaaaatggaaacacagctgtgatcattgcgtgcaccacaaataatagcgaagca
ttgcagattttgcttaaaaaaggagctaagccatgtaaatcaaataaatggggatgtttc
cctattcaccaagctgcattttcaggttccaaagaatgcatggaaataatactaaggttt
ggtgaagagcatgggtacagtagacagttgcacattaactttatgaataatgggaaagcc
acccctctccacctggctgtgcaaaatggtgacttggaaatgatcaaaatgtgcctggac
aatggtgcacaaatagacccagtggagaagggaaggtgcacagccattcattttgctgcc
acccagggagccactgagattgttaaactgatgatatcgtcctattctggtagcgtggat
attgttaacacaaccgatggatgtcatgagaccatgcttcacagagcttcattgtttgat
caccatgagctagcagactatttaatttcagtgggagcagatattaataagatcgattct
gaaggacgctctccacttatattagcaactgcttctgcatcttggaatattgtaaatttg
ctactctctaaaggtgcccaagtagacataaaagataattttggacgtaattttctgcat
ttaactgtacagcaaccttatggattaaaaaatctgcgacctgaatttatgcagatgcaa
cagatcaaagagctggtaatggatgaagacaacgatgggtgtactcctctacattatgca
tgtagacaggggggccctggttctgtaaataacctacttggctttaatgtgtccattcat
tccaaaagcaaagataagaaatcacctctgcattttgcagccagttatgggcgtatcaat
acctgtcagaggctcctacaagacataagtgatacgaggcttctgaatgaaggtgacctt
catggaatgactcctctccatctggcagcaaagaatggacatgataaagtagttcagctt
cttctgaaaaaaggtgcattgtttctcagtgaccacaatggctggacagctttgcatcat
gcgtccatgggcgggtacactcagaccatgaaggtcattcttgatactaatttgaagtgc
acagatcgcctggatgaagacgggaacactgcacttcactttgctgcaagggaaggccac
gccaaagccgttgcgcttcttctgagccacaatgctgacatagtcctgaacaagcagcag
gcctcctttttgcaccttgcacttcacaataagaggaaggaggttgttcttacgatcatc
aggagcaaaagatgggatgaatgtcttaagattttcagtcataattctccaggcaataaa
tgtccaattacagaaatgatagaatacctccctgaatgcatgaaggtacttttagatttc
tgcatgttgcattccacagaagacaagtcctgccgagactattatatcgagtataatttc
aaatatcttcaatgtccattagaattcaccaaaaaaacacctacacaggatgttatatat
gaaccgcttacagccctcaacgcaatggtacaaaataaccgcatagagcttctcaatcat
cctgtgtgtaaagaatatttactcatgaaatggttggcttatggatttagagctcatatg
atgaatttaggatcttactgtcttggtctcatacctatgaccattctcgttgtcaatata
aaaccaggaatggctttcaactcaactggcatcatcaatgaaactagtgatcattcagaa
atactagataccacgaattcatatctaataaaaacttgtatgattttagtgtttttatca
agtatatttgggtattgcaaagaagcggggcaaattttccaacagaaaaggaattatttt
atggatataagcaatgttcttgaatggattatctacacgacgggcatcatttttgtgctg
cccttgtttgttgaaataccagctcatctgcagtggcaatgtggagcaattgctgtttac
ttctattggatgaatttcttattgtatcttcaaagatttgaaaattgtggaatttttatt
gttatgttggaggtaattttgaaaactttgttgaggtctacagttgtatttatcttcctt
cttctggcttttggactcagcttttacatcctcctgaatttacaggatcccttcagctct
ccattgctttctataatccagaccttcagcatgatgctaggagatatcaattatcgagag
tccttcctagaaccatatctgagaaatgaattggcacatccagttctgtcctttgcacaa
cttgtttccttcacaatatttgtcccaattgtcctcatgaatttacttattggtttggca
gttggcgacattgctgaggtccagaaacatgcatcattgaagaggatagctatgcaggtg
gaacttcataccagcttagagaagaagctgccactttggtttctacgcaaagtggatcag
aaatccaccatcgtgtatcccaacaaacccagatctggtgggatgttattccatatattc
tgttttttattttgcactggggaaataagacaagaaataccaaatgctgataaatcttta
gaaatggaaatattaaagcagaaataccggctgaaggatcttacttttctcctggaaaaa
cagcatgagctcattaaactgatcattcagaagatggagatcatctctgagacagaggat
gatgatagccattgttcttttcaagacaggtttaagaaagagcagatggaacaaaggaat
agcagatggaatactgtgttgagagcagtcaaggcaaaaacacaccatcttgagccttag

DBGET integrated database retrieval system