KEGG   Homo sapiens (human): 89910Help
Entry
89910             CDS       T01001                                 

Gene name
UBE3B, BPIDS, KOS
Definition
(RefSeq) ubiquitin protein ligase E3B
  KO
K10588  
ubiquitin-protein ligase E3 B [EC:2.3.2.26]
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    89910 (UBE3B)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     89910 (UBE3B)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  HECT type E3
   89910 (UBE3B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q7Z3V4(Tbio)
UniProt: 
Position
12q24.11
AA seq 1068 aa AA seqDB search
MFTLSQTSRAWFIDRARQAREERLVQKERERAAVVIQAHVRSFLCRSRLQRDIRREIDDF
FKADDPESTKRSALCIFKIARKLLFLFRIKEDNERFEKLCRSILSSMDAENEPKVWYVSL
ACSKDLTLLWIQQIKNILWYCCDFLKQLKPEILQDSRLITLYLTMLVTFTDTSTWKILRG
KGESLRPAMNHICANIMGHLNQHGFYSVLQILLTRGLARPRPCLSKGTLTAAFSLALRPV
IAAQFSDNLIRPFLIHIMSVPALVTHLSTVTPERLTVLESHDMLRKFIIFLRDQDRCRDV
CESLEGCHTLCLMGNLLHLGSLSPRVLEEETDGFVSLLTQTLCYCRKYVSQKKSNLTHWH
PVLGWFSQSVDYGLNESMHLITKQLQFLWGVPLIRIFFCDILSKKLLESQEPAHAQPASP
QNVLPVKSLLKRAFQKSASVRNILRPVGGKRVDSAEVQKVCNICVLYQTSLTTLTQIRLQ
ILTGLTYLDDLLPKLWAFICELGPHGGLKLFLECLNNDTEESKQLLAMLMLFCDCSRHLI
TILDDIEVYEEQISFKLEELVTISSFLNSFVFKMIWDGIVENAKGETLELFQSVHGWLMV
LYERDCRRRFTPEDHWLRKDLKPSVLFQELDRDRKRAQLILQYIPHVIPHKNRVLLFRTM
VTKEKEKLGLVETSSASPHVTHITIRRSRMLEDGYEQLRQLSQHAMKGVIRVKFVNDLGV
DEAGIDQDGVFKEFLEEIIKRVFDPALNLFKTTSGDERLYPSPTSYIHENYLQLFEFVGK
MLGKAVYEGIVVDVPFASFFLSQLLGHHHSVFYSSVDELPSLDSEFYKNLTSIKRYDGDI
TDLGLTLSYDEDVMGQLVCHELIPGGKTIPVTNENKISYIHLMAHFRMHTQIKNQTAALI
SGFRSIIKPEWIRMFSTPELQRLISGDNAEIDLEDLKKHTVYYGGFHGSHRVIIWLWDIL
ASDFTPDERAMFLKFVTSCSRPPLLGFAYLKPPFSIRCVEVSDDQDTGDTLGSVLRGFFT
IRKREPGGRLPTSSTCFNLLKLPNYSKKSVLREKLRYAISMNTGFELS
NT seq 3207 nt NT seq  +upstreamnt  +downstreamnt
atgttcaccctgtctcagacctcgagagcatggttcatcgatagagcccgtcaggcacga
gaagaaaggcttgtgcagaaggaacgggagcgggcagctgttgtgatccaggcccatgtc
cggagttttctctgtcggagtcgactgcagagagatatcaggagagagattgatgacttt
tttaaagcagatgaccctgagtccactaaaagaagtgcactttgtattttcaagattgcc
aggaaactgctgttcctattcagaatcaaagaggataatgagagatttgagaagttgtgt
cgcagcatcctgagcagcatggatgctgagaatgagcctaaggtgtggtatgtgtccctg
gcttgttctaaggacctcaccctcctttggattcaacagatcaagaacattttgtggtac
tgctgtgattttctcaagcagctcaagcctgaaatcctgcaggactcccgactcatcacc
ctgtacctcacgatgcttgtcaccttcacagacacttcaacgtggaaaattcttcgggga
aaaggtgaaagtcttcgaccagcgatgaaccacatttgtgcaaatataatgggacatctc
aaccagcatggattttattctgtgctgcagatattgttaacccgtggcctggcaagaccc
cgtccttgtctatccaaaggcactttaacagcagctttttctctagcgttacgccctgtg
attgctgcacagttctcagacaatctgattcggccgttcctcatccacatcatgtctgtg
cctgctctggtgactcatctcagcacagtgacccctgagcgcctcactgttttagaatcc
catgacatgcttcgtaaattcatcatatttttaagagaccaagatcgatgccgtgatgta
tgtgaaagtttagaaggatgccatacgctttgtctaatgggcaacctcctacacttgggc
tccctcagccccagagtgttagaggaggagacagatgggttcgtgagtttgctcacccag
acgctgtgctactgtcggaagtatgtgtctcagaagaagtccaacctgacccactggcat
cctgtccttggctggttctcccaatctgtggattatggccttaacgagtcaatgcacttg
atcaccaaacagctgcagttcttgtggggggtgcctctgatccggatcttcttctgtgac
atcctgagcaagaagctactggagagccaggagccagcccacgcacagccagcatcccct
cagaatgtgctcccagtgaagagtctcctaaagcgtgcttttcaaaagtcggcatcagtc
cggaatattctcaggcctgtcgggggtaaacgggtcgactctgcagaagtccagaaggtt
tgcaacatctgtgtcctctaccagacctcgctgacaactctcacacagattcggctgcag
atactcacaggtctcacttaccttgatgacctgcttcccaaactgtgggcatttatctgt
gagctcgggccccacggagggttaaagctcttcttggaatgcctgaacaatgacactgaa
gagtccaagcaactcttggccatgctgatgctgttctgtgactgttcgcggcacctcatc
acaatccttgatgacattgaagtttatgaagaacagatttcattcaaactggaagagctg
gtcactatctcctctttcctgaattcttttgtgtttaagatgatctgggatggaattgta
gagaacgccaagggtgagaccttggagctgttccagtctgtccacgggtggcttatggtg
ctgtacgagcgggactgccggcggcgcttcacccccgaggaccactggctgcgaaaggat
ctcaaacctagcgtgctcttccaagaactcgacagggacagaaaacgggcacagttgatc
ctgcagtacatcccacatgtcatccctcacaaaaacagagttctactgtttcgaaccatg
gttaccaaggagaaggagaaactggggctggtggaaaccagctctgcctccccgcatgtc
actcacatcaccatccgccggtccaggatgctggaggacggctacgagcagcttaggcag
ctctcccagcacgccatgaagggggtcatccgtgtgaagtttgtcaatgacctcggggtg
gacgaagcagggattgatcaagacggtgtttttaaggagttcttggaagagatcatcaag
agagtttttgacccagcactcaatctgttcaagacaaccagtggggatgagaggctgtac
ccctcacccacatcctacatccatgagaattacctgcagctcttcgagtttgtggggaag
atgctggggaaggctgtgtatgagggaattgtggtggacgtgccatttgcatccttcttc
ctgagccaactgcttgggcaccaccacagcgtcttctatagctcggtggatgaactgcct
tctctggactccgagttctataaaaacctcacctccatcaagcgctatgatggggacatc
actgacctgggcctgacgctgtcttacgacgaggacgtcatgggtcagcttgtttgccat
gaactgattcctggagggaagaccattcctgttacaaatgaaaataaaattagctacatc
catctgatggcacattttcgaatgcacactcaaataaaaaaccaaacagctgccctcatt
agcggattccgttccattatcaaacccgagtggatccgaatgttctcaactcctgaactg
cagcgtctcatctctggcgacaatgctgagattgatctggaagatttaaagaagcacaca
gtctactacggtggtttccatggaagtcacagagtcatcatctggctctgggatattctg
gcctccgacttcacaccggatgagagagctatgtttctgaagttcgtgaccagctgctcc
agacccccgctcctgggattcgcctacctcaagcctccattctccatccgctgcgtggag
gtgtcggacgatcaggacaccggggacactctgggcagcgtcctccggggcttcttcacc
atccgcaagcgggagccaggcggccgcctgcccacctcctccacctgcttcaacctgctc
aagctgcccaactacagcaagaagagcgtcctccgcgagaagctgcgctacgccatcagc
atgaacacgggctttgaactctcctag

DBGET integrated database retrieval system