KEGG   Homo sapiens (human): 8995Help
Entry
8995              CDS       T01001                                 

Gene name
TNFSF18, AITRL, GITRL, TL6, TNLG2A, hGITRL
Definition
(RefSeq) TNF superfamily member 18
  KO
K05479  tumor necrosis factor ligand superfamily member 18
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    8995 (TNFSF18)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Tumor necrosis fators
   8995 (TNFSF18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF zf-LITAF-like
Motif
Other DBs
NCBI-GeneID: 8995
NCBI-ProteinID: NP_005083
OMIM: 603898
HGNC: 11932
Ensembl: ENSG00000120337
Vega: OTTHUMG00000034835
Pharos: Q9UNG2(Tbio)
UniProt: Q9UNG2 A0A0U5JXL4
Structure
PDB: 

Jmol
Position
1q25.1
AA seq 199 aa AA seqDB search
MTLHPSPITCEFLFSTALISPKMCLSHLENMPLSHSRTQGAQRSSWKLWLFCSIVMLLFL
CSFSWLIFIFLQLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIY
GQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQV
LKNNTYWGIILLANPQFIS
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgacattgcatccttcacccatcacttgtgaatttttgttttccacagctctcatttct
ccaaaaatgtgtttgagccacttggaaaatatgcctttaagccattcaagaactcaagga
gctcagagatcatcctggaagctgtggctcttttgctcaatagttatgttgctatttctt
tgctccttcagttggctaatctttatttttctccaattagagactgctaaggagccctgt
atggctaagtttggaccattaccctcaaaatggcaaatggcatcttctgaacctccttgc
gtgaataaggtgtctgactggaagctggagatacttcagaatggcttatatttaatttat
ggccaagtggctcccaatgcaaactacaatgatgtagctccttttgaggtgcggctgtat
aaaaacaaagacatgatacaaactctaacaaacaaatctaaaatccaaaatgtaggaggg
acttatgaattgcatgttggggacaccatagacttgatattcaactctgagcatcaggtt
ctaaaaaataatacatactggggtatcattttactagcaaatccccaattcatctcctag

DBGET integrated database retrieval system