KEGG   Homo sapiens (human): 8995Help
Entry
8995              CDS       T01001                                 

Gene name
TNFSF18, AITRL, GITRL, TL6, hGITRL
Definition
tumor necrosis factor (ligand) superfamily, member 18
Orthology
K05479  
tumor necrosis factor ligand superfamily member 18
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Class
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q23
AA seq 199 aa AA seqDB search
MTLHPSPITCEFLFSTALISPKMCLSHLENMPLSHSRTQGAQRSSWKLWLFCSIVMLLFL
CSFSWLIFIFLQLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIY
GQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQV
LKNNTYWGIILLANPQFIS
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgacattgcatccttcacccatcacttgtgaatttttgttttccacagctctcatttct
ccaaaaatgtgtttgagccacttggaaaatatgcctttaagccattcaagaactcaagga
gctcagagatcatcctggaagctgtggctcttttgctcaatagttatgttgctatttctt
tgctccttcagttggctaatctttatttttctccaattagagactgctaaggagccctgt
atggctaagtttggaccattaccctcaaaatggcaaatggcatcttctgaacctccttgc
gtgaataaggtgtctgactggaagctggagatacttcagaatggcttatatttaatttat
ggccaagtggctcccaatgcaaactacaatgatgtagctccttttgaggtgcggctgtat
aaaaacaaagacatgatacaaactctaacaaacaaatctaaaatccaaaatgtaggaggg
acttatgaattgcatgttggggacaccatagacttgatattcaactctgagcatcaggtt
ctaaaaaataatacatactggggtatcattttactagcaaatccccaattcatctcctag

DBGET integrated database retrieval system