KEGG   Homo sapiens (human): 8997Help
Entry
8997              CDS       T01001                                 

Gene name
KALRN, ARHGEF24, CHD5, CHDS5, DUET, DUO, HAPIP, TRAD
Definition
(RefSeq) kalirin, RhoGEF kinase (EC:2.7.11.1)
  KO
K15048  
kalirin [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     8997 (KALRN)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CAMK group
  Trio family [OT]
   8997 (KALRN)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   8997 (KALRN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q21.2
AA seq 2986 aa AA seqDB search
MTDRFWDQWYLWYLRLLRLLDRGSFRNDGLKASDVLPILKEKVAFVSGGRDKRGGPILTF
PARSNHDRIRQEDLRKLVTYLASVPSEDVCKRGFTVIIDMRGSKWDLIKPLLKTLQEAFP
AEIHVALIIKPDNFWQKQKTNFGSSKFIFETSMVSVEGLTKLVDPSQLTEEFDGSLDYNH
EEWIELRLSLEEFFNSAVHLLSRLEDLQEMLARKEFPVDVEGSRRLIDEHTQLKKKVLKA
PVEELDREGQRLLQCIRCSDGFSGRNCIPGSADFQSLVPKITSLLDKLHSTRQHLHQMWH
VRKLKLDQCFQLRLFEQDAEKMFDWISHNKELFLQSHTEIGVSYQYALDLQTQHNHFAMN
SMNAYVNINRIMSVASRLSEAGHYASQQIKQISTQLDQEWKSFAAALDERSTILAMSAVF
HQKAEQFLSGVDAWCKMCSEGGLPSEMQDLELAIHHHQTLYEQVTQAYTEVSQDGKALLD
VLQRPLSPGNSESLTATANYSKAVHQVLDVVHEVLHHQRRLESIWQHRKVRLHQRLQLCV
FQQDVQQVLDWIENHGEAFLSKHTGVGKSLHRARALQKRHDDFEEVAQNTYTNADKLLEA
AEQLAQTGECDPEEIYKAARHLEVRIQDFVRRVEQRKLLLDMSVSFHTHTKELWTWMEDL
QKEMLEDVCADSVDAVQELIKQFQQQQTATLDATLNVIKEGEDLIQQLRSAPPSLGEPSE
ARDSAVSNNKTPHSSSISHIESVLQQLDDAQVQMEELFHERKIKLDIFLQLRIFEQYTIE
VTAELDAWNEDLLRQMNDFNTEDLTLAEQRLQRHTERKLAMNNMTFEVIQQGQDLHQYIT
EVQASGIELICEKDIDLAAQVQELLEFLHEKQHELELNAEQTHKRLEQCLQLRHLQAEVK
QVLGWIRNGESMLNASLVNASSLSEAEQLQREHEQFQLAIESLFHATSLQKTHQSALQVQ
QKAEVLLQAGHYDADAIRECAEKVALHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLE
SLEQEYRRDEDWCGGRDKLGPAAEIDHVIPLISKHLEQKEAFLKACTLARRNAEVFLKYI
HRNNVSMPSVASHTRGPEQQVKAILSELLQRENRVLHFWTLKKRRLDQCQQYVVFERSAK
QALDWIQETGEFYLSTHTSTGETTEETQELLKEYGEFRVPAKQTKEKVKLLIQLADSFVE
KGHIHATEIRKWVTTVDKHYRDFSLRMGKYRYSLEKALGVNTEDNKDLELDIIPASLSDR
EVKLRDANHEVNEEKRKSARKKEFIMAELLQTEKAYVRDLHECLETYLWEMTSGVEEIPP
GILNKEHIIFGNIQEIYDFHNNIFLKELEKYEQLPEDVGHCFVTWADKFQMYVTYCKNKP
DSNQLILEHAGTFFDEIQQRHGLANSISSYLIKPVQRITKYQLLLKELLTCCEEGKGELK
DGLEVMLSVPKKANDAMHVSMLEGFDENLDVQGELILQDAFQVWDPKSLIRKGRERHLFL
FEISLVFSKEIKDSSGHTKYVYKNKLLTSELGVTEHVEGDPCKFALWSGRTPSSDNKTVL
KASNIETKQEWIKNIREVIQERIIHLKGALKEPLQLPKTPAKQRNNSKRDGVEDIDSQGD
GSSQPDTISIASRTSQNTVDSDKLSGGCELTVVLQDFSAGHSSELTIQVGQTVELLERPS
ERPGWCLVRTTERSPPLEGLVPSSALCISHSRSSVEMDCFFPLVKDAYSHSSSENGGKSE
SVANLQAQPSLNSIHSSPGPKRSTNTLKKWLTSPVRRLNSGKADGNIKKQKKVRDGRKSF
DLGSPKPGDETTPQGDSADEKSKKGWGEDEPDEESHTPLPPPMKIFDNDPTQDEMSSSLL
AARQASTEVPTAADLVNAIEKLVKNKLSLEGSSYRGSLKDPAGCLNEGMAPPTPPKNPEE
EQKAKALRGRMFVLNELVQTEKDYVKDLGIVVEGFMKRIEEKGVPEDMRGKDKIVFGNIH
QIYDWHKDFFLAELEKCIQEQDRLAQLFIKHERKLHIYVWYCQNKPRSEYIVAEYDAYFE
EVKQEINQRLTLSDFLIKPIQRITKYQLLLKDFLRYSEKAGLECSDIEKAVELMCLVPKR
CNDMMNLGRLQGFEGTLTAQGKLLQQDTFYVIELDAGMQSRTKERRVFLFEQIVIFSELL
RKGSLTPGYMFKRSIKMNYLVLEENVDNDPCKFALMNRETSERVVLQAANADIQQAWVQD
INQVLETQRDFLNALQSPIEYQRKERSTAVMRSQPARLPQASPRPYSSVPAGSEKPPKGS
SYNPPLPPLKISTSNGSPGFEYHQPGDKFEASKQNDLGGCNGTSSMAVIKDYYALKENEI
CVSQGEVVQVLAVNQQNMCLVYQPASDHSPAAEGWVPGSILAPLTKATAAESSDGSIKKS
CSWHTLRMRKRAEVENTGKNEATGPRKPKDILGNKVSVKETNSSEESECDDLDPNTSMEI
LNPNFIQEVAPEFLVPLVDVTCLLGDTVILQCKVCGRPKPTITWKGPDQNILDTDNSSAT
YTVSSCDSGEITLKICNLMPQDSGIYTCIATNDHGTTSTSATVKVQGVPAAPNRPIAQER
SCTSVILRWLPPSSTGNCTISGYTVEYREEGSQIWQQSVASTLDTYLVIEDLSPGCPYQF
RVSASNPWGISLPSEPSEFVRLPEYDAAADGATISWKENFDSAYTELNEIGRGRFSIVKK
CIHKATRKDVAVKFVSKKMKKKEQAAHEAALLQHLQHPQYITLHDTYESPTSYILILELM
DDGRLLDYLMNHDELMEEKVAFYIRDIMEALQYLHNCRVAHLDIKPENLLIDLRIPVPRV
KLIDLEDAVQISGHFHIHHLLGNPEFAAPEVIQGIPVSLGTDIWSIGVLTYVMLSGVSPF
LDESKEETCINVCRVDFSFPHEYFCGVSNAARDFINVILQEDFRRRPTAATCLQHPWLQP
HNGSYSKIPLDTSRLACFIERRKHQNDVRPIPNVKSYIVNRVNQGT
NT seq 8961 nt NT seq  +upstreamnt  +downstreamnt
atgacggaccgcttctgggaccagtggtatctctggtatctccgcttgctccggctgctg
gatcgagggtcttttcggaatgatggtttgaaagcttctgatgtccttcctatcctaaag
gaaaaggtggccttcgtgtctgggggtcgtgataagcgaggcggacccatcctgaccttc
cctgctcgcagcaatcatgacagaataagacaggaagacctgcggaaactcgtgacgtat
ttggccagcgtgccaagtgaggacgtgtgcaaacgtggcttcactgtcatcatcgacatg
cggggctccaagtgggacctcatcaagcccctcctcaaaacgctgcaggaagcctttcca
gctgagatccatgtggccctcatcattaaacccgacaacttctggcagaaacagaagacc
aactttggcagctccaaattcatctttgagacgagcatggtatctgtggagggcctcaca
aagctggtggacccctcccagctgacggaggagtttgatggctccctggactacaaccat
gaggagtggatcgaactgcggctctccctggaggagttcttcaacagcgccgtgcacctg
ctctcgcgcctcgaggacctccaggagatgctagcccggaaggagtttcctgtggatgtg
gagggctctcggcggctcattgacgaacacacacagctcaagaaaaaggtgctgaaggcc
cctgtggaggagctggaccgggaggggcagcggctgctgcagtgcatccgctgcagcgac
ggcttctcaggacgcaactgcatcccgggcagtgctgacttccagagcctggtgcccaag
atcaccagtctcctggacaagctgcactccacccggcagcacctgcaccagatgtggcat
gtgcgcaagctcaagctggaccagtgctttcagctgcggctcttcgagcaggatgctgag
aagatgtttgactggataagccacaacaaggagttattcctccagagccacacggagatc
ggagtcagctaccagtacgcccttgacctccagacgcagcacaatcactttgccatgaac
tccatgaatgcctatgtcaacatcaaccgcatcatgtccgtggcttcccgcctctctgag
gccggtcattatgcctcacaacaaatcaagcagatctccacccagctggaccaggagtgg
aagagcttcgctgctgccctggatgaacgcagcaccatcctcgccatgtctgctgtgttc
caccagaaggctgagcagttcctgtcgggagtggatgcctggtgcaagatgtgcagtgaa
ggtggtctgccatccgagatgcaagacctagagctggcaatccaccaccaccagaccttg
tatgagcaggtgacccaagcctacacagaggtcagccaggatggcaaagcactacttgat
gtgctgcagcggcccctgagccctgggaactccgaatccctcacggccacagccaactac
tccaaggcagtgcaccaggtgctggacgtggtgcatgaggtgttacatcaccagcgacgg
ctggagagcatctggcagcaccgcaaggtgcggctccaccagcggctgcagctctgcgtc
ttccagcaggatgtacagcaggtgttggactggattgaaaaccatggtgaggcctttctc
agcaaacacactggagttgggaagtccctacatcgagcccgggccctgcagaagaggcat
gatgactttgaagaggtggctcagaatacgtacaccaatgcggacaagctcctagaagca
gcagagcagttggctcagacgggggaatgtgaccccgaggagatctacaaggcagctcga
cacctggaggtgcgcatccaagacttcgtgcgcagggtggagcagcggaagcttctcctg
gacatgtctgtttccttccacacacacaccaaagagttgtggacatggatggaagacctt
cagaaggagatgttggaggatgtctgtgcagattctgtggatgcagtccaggaactgatc
aagcagttccagcagcagcagaccgccactctagatgccacactcaatgtcatcaaggaa
ggcgaagaccttatccagcagctcaggtcagcgcctccctccctcggggagcccagcgag
gccagggactcggctgtgtccaacaacaaaacaccccacagcagctccatcagccacatc
gagtcggtcctgcagcagcttgatgatgcccaggtgcagatggaggagctgttccacgag
cggaagatcaagctggacatcttcctgcaactgcgcatctttgagcagtacaccatcgag
gtgacagcagagctagacgcctggaatgaagacttgcttcggcagatgaatgacttcaac
acagaggacctaaccctggcagaacagcggctgcagcgccacacagaacggaagctagcc
atgaacaacatgacctttgaggttatccagcagggacaggatctgcaccagtacatcacg
gaggtccaggcatcaggaattgagttgatctgtgaaaaagacattgatctggcagcccag
gtgcaagagttattggaatttctccatgagaagcagcatgaattggagctcaatgcagag
cagactcataagcggctagagcagtgcctccaattacgtcacctccaggctgaagtcaaa
caggttctgggatggatccgcaatggagagtcaatgctcaacgccagcctggtcaatgcc
agctctttgtcggaagcagagcagctgcagcgggagcacgagcagttccaactggccatc
gagtccctctttcatgccacttccttgcagaagacgcaccagagtgccctgcaggtacag
cagaaagccgaggtgctgctccaggccggccactacgatgccgatgccatccgggaatgt
gctgagaaggtggccctccactggcagcagctcatgctgaagatggaagaccggctaaaa
ttggtcaatgcctctgtggccttttacaaaacttctgaacaggtgtgtagtgtcctggag
agcttagagcaagaataccggagagatgaggactggtgtggtggacgagataagctgggg
ccagcagcagagatcgaccatgtcattcccctcatcagcaaacatttggaacaaaaggag
gcctttcttaaggcctgcaccctggctcggcggaatgctgaggtgtttctcaagtacatc
cacaggaacaacgtcagcatgcccagtgtcgccagccacactcggggacccgagcaacaa
gtgaaagccatcctgagtgagctcctgcagagggagaatcgcgtgctgcatttctggacc
ttgaagaagcggcggttagaccaatgccagcaatatgtggtgttcgagcgcagcgctaag
caggcgcttgactggatccaagaaacaggtgaattttacctctcaacacatacctccact
ggagagaccacagaggagactcaggaactgctgaaagaatatggggaattcagggtgcct
gccaagcaaacaaaggagaaggtgaagcttctgattcagctggccgatagctttgtggaa
aaaggccacattcatgccacggagataaggaaatgggtgaccacggtggacaagcactac
agagatttctccctgaggatgggaaagtaccgatactcactggagaaagccctaggagtc
aacacagaggataataaggacctggagctggatattatcccagcaagcctttcggatcgg
gaggtcaagctgcgggacgccaaccacgaagtcaatgaagagaagcggaagtcagcccgg
aagaaagaatttattatggctgaactactccagacagagaaggcttatgtaagggatttg
catgagtgcttagagacctacctgtgggaaatgaccagtggtgtggaggagatcccccct
gggatcctcaataaagagcatatcatctttggcaacatccaagagatctacgatttccat
aacaacatcttcctcaaagagctggagaagtacgagcaactgcctgaggatgtgggacac
tgctttgttacctgggcagacaaatttcagatgtatgtcacctactgtaaaaacaagcct
gattccaaccagcttatcctggagcatgcgggcaccttctttgatgagatacaacagcgg
catggtctggccaactccatctcttcctacctaattaagcctgtccaaaggatcaccaaa
tatcaactgctcctgaaggaacttttaacttgctgtgaagaagggaaaggggagctcaag
gatggcctggaggtgatgctcagtgtcccaaagaaagccaatgatgccatgcatgtcagc
atgctggaagggttcgacgagaacctggatgtgcagggggagttgattctccaggatgcc
tttcaagtgtgggacccgaagtcgctgatccggaaggggcgggagcggcacttgttcctc
tttgagatctccttggtttttagcaaggagatcaaagattcttcaggacacacgaaatat
gtttacaagaacaagctactgacctcagagctgggtgtgaccgagcacgtggagggcgat
ccctgcaaattcgccttgtggtctgggcgcaccccatcctcagacaataaaacagtgctg
aaagcctccaacattgaaaccaagcaggagtggatcaagaacattcgagaagtgattcaa
gaaaggatcattcacctgaaaggagctttaaaggagccacttcagctccccaaaacacca
gccaaacagaggaacaatagtaagagggatggagtggaggatattgacagccagggggat
gggagcagccaaccagacaccatctccattgcttctaggacctctcagaacacagtggac
agtgacaagctctctggtggatgtgagctgacagtggtcctccaggacttcagtgcgggc
cacagcagtgagctgaccatccaggtggggcagacggtagagctgctggagcggcccagc
gagcggcctggttggtgtctggtccgtaccaccgaacggagcccgcccttggagggtctg
gtccccagcagcgccctgtgcatctcacactcccgaagcagcgtggagatggactgcttc
ttccccttggtgaaagatgcatactctcattcctcaagcgagaatggaggcaagtccgag
tccgtggccaacctgcaggcccagccctccctgaactccatccacagttccccgggtccc
aagcgctccaccaacactcttaagaagtggctgacgagtcctgtgcgtcggcttaacagc
gggaaggcagatggaaacatcaaaaagcagaagaaagttcgcgatggtcggaagagcttt
gacctgggatctcccaagcctggggatgaaacaacccctcagggagacagcgctgatgag
aagagcaagaaaggttggggtgaagatgagccggatgaagagtcacacacacccctccca
ccacctatgaagatttttgacaacgaccctacacaggatgaaatgtcctcctctttgcta
gcagcccggcaggcttccactgaagtacctactgctgcagaccttgtcaatgcaatagaa
aagttggtcaaaaacaagctgagtctagaaggaagctcataccgggggagcttgaaagac
cctgcaggctgcctgaatgaggggatggccccacccacacctcctaaaaacccagaagaa
gaacagaaagccaaggccctgagaggcaggatgtttgtcctgaatgagctggtacagaca
gagaaagactatgtcaaggatctgggcattgtggtggagggcttcatgaagagaatagaa
gaaaagggtgtccctgaggatatgcgaggaaaggacaaaatcgtgtttggaaatattcat
cagatttatgactggcataaggattttttcctggcggaactggaaaagtgtatccaggag
caagacagattggcacagctctttattaagcacgagcggaagctgcacatctacgtgtgg
tattgtcagaataagccgcgctcagagtacatcgttgctgagtatgacgcctactttgag
gaggtaaaacaggagataaatcagaggctgacactgagtgacttcctcatcaagcccatt
cagagaataacaaaataccagttgctcctcaaggacttcctgagatacagtgagaaggct
ggtttggagtgttcagatattgagaaagcagtggagttaatgtgccttgttcccaaacgc
tgcaatgacatgatgaatctaggacgtctgcagggctttgagggcactctgactgctcag
gggaagctgctgcagcaggacacattctatgtgatcgagctggatgcaggcatgcagtcc
cggaccaaagagaggcgcgtgttcctcttcgagcagattgtcatcttcagtgaactgctc
aggaagggatccctcacccctggctacatgttcaaaaggagcatcaagatgaattacttg
gtcctggaggagaatgtggacaatgatccctgcaagtttgcactcatgaacagagagact
tctgagagggttgttctgcaagccgccaacgctgacatccagcaggcctgggtgcaggac
atcaatcaagtcttagaaacacagcgagactttttgaatgcactgcaatcgcccattgag
tatcaacggaaagaaaggagcacagctgtgatgaggtctcaacctgccaggcttccccaa
gccagccccaggccctactcctctgttcctgcgggctcagagaagcccccaaagggctcc
agctataacccacctctgcctcccctgaagatatctacctccaatggcagtccagggttt
gaataccaccagcctggggacaagttcgaagccagcaagcagaacgacctgggaggctgc
aatgggacctcgtccatggccgtgatcaaagattactatgcactgaaggagaatgaaatc
tgtgtgagccaaggtgaggtggtccaggtcctcgccgtcaaccagcagaacatgtgtctg
gtgtaccagcctgccagcgaccattcccccgccgccgagggctgggtcccaggcagcatc
ctggcgcccctcaccaaagccacagcagcagaaagtagtgacgggagcatcaagaagtca
tgttcatggcatactctacgcatgagaaagcgggcggaagtggagaacacgggtaaaaat
gaagccacagggcctcgtaaacccaaggatattctgggcaacaaagtctctgttaaagag
acgaacagttccgaggaatcagagtgtgatgatcttgaccctaatactagcatggagatc
ttaaatccaaatttcatccaagaagtggccccagaattccttgtgcccttggtggatgtg
acctgcttgcttggggacacagtgatactgcagtgcaaagtctgtgggcggccaaagccc
accatcacttggaagggtccagaccagaacatccttgacactgataacagctcagccaca
tacacggtctcctcttgtgattctggagaaatcaccctgaagatctgtaatctgatgccc
caagacagtgggatttatacctgcatagcaacaaatgaccacgggaccacatcaacgtct
gcaacagtcaaagtgcaaggtgttccagcagcccctaaccgccccattgcccaggagaga
agctgcacctccgtgattctccgctggctgcccccctccagcacaggaaactgcactatt
tctggttacactgtggagtacagagaggaaggttctcagatctggcagcagtcagtggct
tcgaccttggacacttacctcgtcatcgaagaccttagtcccgggtgtccttatcagttc
agagtcagtgccagtaacccctggggaatcagccttcccagcgagccctcggagtttgtg
cgacttccagaatatgatgctgctgctgatggtgccaccatttcttggaaggaaaatttt
gactcagcttacactgagctgaatgaaattggaagaggccgtttctctatagtaaagaaa
tgcattcacaaagctacccgcaaagatgtggctgtgaaatttgttagcaaaaaaatgaag
aagaaagaacaggctgcccacgaggctgccctgcttcagcacctacagcacccccagtac
atcactctccatgacacctatgagtcccccacatcctacatcctgatcttggaactgatg
gatgatggccggctcttagactaccttatgaatcatgatgaactgatggaggaaaaagta
gctttctatatccgagacatcatggaggctctgcagtaccttcacaactgcagggttgca
catttggacataaagcctgaaaacctgctcattgacctacggattccagtgcctcgagtg
aagctcattgacttggaggatgctgtccagatctcgggtcacttccacattcaccacctg
ctggggaaccctgagtttgctgccccagaagtcattcaaggcatccccgtctccctgggg
acagacatctggagcatcggggttctgacatatgtcatgctgagtggggtctcccccttc
ttggatgagagcaaagaggagacatgtatcaacgtatgcagggtggatttcagcttcccc
catgaatacttctgtggtgtgagcaatgctgccagagatttcatcaatgtgatcttacag
gaagattttcggaggcggcccacagcagccacatgcttgcagcatccatggctgcagccc
cataatggcagctactctaagatccccctggacacctcccgcctagcatgcttcatagaa
cgtcgcaagcaccagaatgatgtgcggcctattcccaatgtcaagagctacattgtcaac
cgggtgaaccaagggacgtag

DBGET integrated database retrieval system