KEGG   Homo sapiens (human): 90Help
Entry
90                CDS       T01001                                 

Gene name
ACVR1, ACTRI, ACVR1A, ACVRLK2, ALK2, FOP, SKR1, TSRI
Definition
activin A receptor, type I (EC:2.7.11.30)
Orthology
K04675  
activin receptor type-1 [EC:2.7.11.30]
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
TGF-beta signaling pathway
Disease
H00430  
Fibrodysplasia ossificans progressiva (FOP)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    90 (ACVR1)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    90 (ACVR1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     90 (ACVR1)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: TKL group
  TGFBR1 family [OT]
   90 (ACVR1)
Enzyme-linked receptors [BR:hsa01020]
 Receptor serine/threonine kinases
  Type I TGF-beta receptor
   90 (ACVR1)
Cytokine receptors [BR:hsa04050]
 TGF-beta receptors
  Type I TGF-beta receptor
   90 (ACVR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q23-q24
AA seq 509 aa AA seqDB search
MVDGVMILPVLIMIALPSPSMEDEKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSIN
DGFHVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNF
HLEVGLIILSVVFAVCLLACLLGVALRKFKRRNQERLNPRDVEYGTIEGLITTNVGDSTL
ADLLDHSCTSGSGSGLPFLVQRTVARQITLLECVGKGRYGEVWRGSWQGENVAVKIFSSR
DEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTL
DTVSCLRIVLSIASGLAHLHIEIFGTQGKPAIAHRDLKSKNILVKKNGQCCIADLGLAVM
HSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWEVARRMVS
NGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQ
NPSARLTALRIKKTLTKIDNSLDKLKTDC
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggtagatggagtgatgattcttcctgtgcttatcatgattgctctcccctcccctagt
atggaagatgagaagcccaaggtcaaccccaaactctacatgtgtgtgtgtgaaggtctc
tcctgcggtaatgaggaccactgtgaaggccagcagtgcttttcctcactgagcatcaac
gatggcttccacgtctaccagaaaggctgcttccaggtttatgagcagggaaagatgacc
tgtaagaccccgccgtcccctggccaagccgtggagtgctgccaaggggactggtgtaac
aggaacatcacggcccagctgcccactaaaggaaaatccttccctggaacacagaatttc
cacttggaggttggcctcattattctctctgtagtgttcgcagtatgtcttttagcctgc
ctgctgggagttgctctccgaaaatttaaaaggcgcaaccaagaacgcctcaatccccga
gacgtggagtatggcactatcgaagggctcatcaccaccaatgttggagacagcacttta
gcagatttattggatcattcgtgtacatcaggaagtggctctggtcttccttttctggta
caaagaacagtggctcgccagattacactgttggagtgtgtcgggaaaggcaggtatggt
gaggtgtggaggggcagctggcaaggggagaatgttgccgtgaagatcttctcctcccgt
gatgagaagtcatggttcagggaaacggaattgtacaacactgtgatgctgaggcatgaa
aatatcttaggtttcattgcttcagacatgacatcaagacactccagtacccagctgtgg
ttaattacacattatcatgaaatgggatcgttgtacgactatcttcagcttactactctg
gatacagttagctgccttcgaatagtgctgtccatagctagtggtcttgcacatttgcac
atagagatatttgggacccaagggaaaccagccattgcccatcgagatttaaagagcaaa
aatattctggttaagaagaatggacagtgttgcatagcagatttgggcctggcagtcatg
cattcccagagcaccaatcagcttgatgtggggaacaatccccgtgtgggcaccaagcgc
tacatggcccccgaagttctagatgaaaccatccaggtggattgtttcgattcttataaa
agggtcgatatttgggcctttggacttgttttgtgggaagtggccaggcggatggtgagc
aatggtatagtggaggattacaagccaccgttctacgatgtggttcccaatgacccaagt
tttgaagatatgaggaaggtagtctgtgtggatcaacaaaggccaaacatacccaacaga
tggttctcagacccgacattaacctctctggccaagctaatgaaagaatgctggtatcaa
aatccatccgcaagactcacagcactgcgtatcaaaaagactttgaccaaaattgataat
tccctcgacaaattgaaaactgactgttga

  All links  
No link information was found.   
DBGET integrated database retrieval system