KEGG   Homo sapiens (human): 900Help
Entry
900               CDS       T01001                                 

Gene name
CCNG1, CCNG
Definition
cyclin G1
Orthology
K10145  
cyclin G1
Organism
hsa  Homo sapiens (human)
Pathway
p53 signaling pathway
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04115 p53 signaling pathway
    900 (CCNG1)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    900 (CCNG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q32-q34
AA seq 295 aa AA seqDB search
MIEVLTTTDSQKLLHQLNALLEQESRCQPKVCGLRLIESAHDNGLRMTARLRDFEVKDLL
SLTQFFGFDTETFSLAVNLLDRFLSKMKVQPKHLGCVGLSCFYLAVKSIEEERNVPLATD
LIRISQYRFTVSDLMRMEKIVLEKVCWKVKATTAFQFLQLYYSLLQENLPLERRNSINFE
RLEAQLKACHCRIIFSKAKPSVLALSIIALEIQAQKCVELTEGIECLQKHSKINGRDLTF
WQELVSKCLTEYSSNKCSKPNVQKLKWIVSGRTARQLKHSYYRITHLPTIPEMVP
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgatagaggtactgacaacaactgactctcagaaactgctacaccagctgaatgccctg
ttggaacaggagtctagatgtcagccaaaggtctgtggtttgagactaattgagtctgca
cacgataatggcctcagaatgactgcaagactaagggactttgaagtaaaagatcttctt
agtctaactcagttctttggctttgacacagagacattttctctagctgtgaatttactg
gacagattcctgtctaaaatgaaggtacagcccaagcaccttgggtgtgttggactgagc
tgcttttatttggctgtaaaatcaatagaagaggaaaggaatgtcccattggcaactgac
ttgatccgaataagtcaatataggtttacggtttcagacttgatgagaatggaaaagatt
gtattggagaaggtgtgttggaaagtcaaagctactactgcctttcaatttctgcaactg
tattattcactccttcaagagaacttgccacttgaaaggagaaatagcattaattttgaa
agactagaagctcaactgaaggcatgtcattgcaggatcatattttctaaagcaaagcct
tctgtgttggcattgtctatcattgcattagagatccaagcacagaagtgtgtagagtta
acagaaggaatagaatgtcttcagaaacattccaagataaatggcagagatctgaccttc
tggcaagagcttgtatccaaatgtttaactgaatattcatcaaataagtgttccaaacca
aatgttcagaagttgaaatggattgtttctgggcgtactgcacggcaattgaagcatagc
tactacagaataactcaccttccaacaattcctgaaatggtcccttaa

DBGET integrated database retrieval system