KEGG   Homo sapiens (human): 9001Help
Entry
9001              CDS       T01001                                 

Gene name
HAP1, HAP2, HIP5, HLP, hHLP1
Definition
(RefSeq) huntingtin associated protein 1
  KO
K04647  
huntingtin-associated protein 1
Organism
hsa  Homo sapiens (human)
Pathway
GABAergic synapse
Huntington's disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Nervous system
   04727 GABAergic synapse
    9001 (HAP1)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    9001 (HAP1)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    9001 (HAP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P54257(Tbio)
UniProt: 
Position
17q21.2
AA seq 619 aa AA seqDB search
MRPKRLGRCCAGSRLGPGDPAALTCAPSPSASPAPEPSAQPQARGTGQRVGSRATSGSQF
LSEARTGARPASEAGAKAGARRPSAFSAIQGDVRSMPDNSDAPWTRFVFQGPFGSRATGR
GTGKAAGIWKTPAAYVGRRPGVSGPERAAFIRELEEALCPNLPPPVKKITQEDVKVMLYL
LEELLPPVWESVTYGMVLQRERDLNTAARIGQSLVKQNSVLMEENSKLEALLGSAKEEIL
YLRHQVNLRDELLQLYSDSDEEDEDEEEEEEEKEAEEEQEEEEAEEDLQCAHPCDAPKLI
SQEALLHQHHCPQLEALQEKLRLLEEENHQLREEASQLDTLEDEEQMLILECVEQFSEAS
QQMAELSEVLVLRLENYERQQQEVARLQAQVLKLQQRCRMYGAETEKLQKQLASEKEIQM
QLQEEETLPGFQETLAEELRTSLRRMISDPVYFMERNYEMPRGDTSSLRYDFRYSEDREQ
VRGFEAEEGLMLAADIMRGEDFTPAEEFVPQEELGAAKKVPAEEGVMEEAELVSEETEGW
EEVELELDEATRMNVVTSALEASGLGPSHLDMNYVLQQLANWQDAHYRRQLRWKMLQKGE
CPHGALPAASRTSCRSSCR
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgcgcccgaagaggttgggccggtgctgcgcggggagccggctcggacccggggaccca
gcagcactcacctgtgcaccttcgccctcagccagtcccgctccggagccctctgcgcag
ccgcaggcacggggcactggacagagagtaggatcccgagccacctctggatcccagttc
ctctcggaagcccgcaccggagctcgcccggcctcggaggctggagccaaggcaggagcc
cggcgcccgtccgcattctcggccatccaaggggatgtccggtctatgcccgacaattcg
gacgcgccgtggacccgcttcgtattccaagggccgtttggttcccgggccactggccgg
gggactggaaaggcagcgggcatctggaagacgccagccgcctacgttggccggcgaccc
ggggtgtccggccctgagcgcgccgcctttattcgggagctggaggaagcactgtgtcct
aacctacctccgccagtcaaaaagatcacccaggaagacgtcaaagtgatgttatatttg
ctggaggagcttctcccacctgtctgggagagcgttacctatgggatggtcctgcagaga
gagagggacctgaacactgcagctcgcatcggccagtccctggtgaaacagaacagtgtt
ttgatggaggagaacagcaagctggaagccctgctgggctcagccaaggaggagatttta
tacctcagacaccaggtgaacttgcgggatgagctcctccagctctactcagattctgat
gaggaggatgaggatgaagaagaggaggaggaagaaaaggaggcagaagaggaacaggaa
gaagaagaagcagaggaagacctgcagtgtgctcatccctgtgatgcccctaagctgatt
tcgcaggaggcattgctgcaccagcaccactgcccacagctggaagccttgcaggagaag
ctgaggctgctggaggaggagaatcatcagctgagagaagaggcctctcaactcgacact
cttgaggatgaggaacagatgctcattctggagtgtgtggagcagttttcggaggccagc
caacagatggctgagctgtcggaggtgctggtgctcaggctggaaaactatgaacggcag
cagcaggaggtcgctcggctgcaggcccaggtgctgaagctgcagcagcgctgccggatg
tatggggctgagactgaaaagttgcagaagcagctggcttcggagaaggaaatccagatg
cagctccaggaagaggagactcttcctggtttccaggagacgctggctgaggagctcaga
acgtctctaaggaggatgatctcagaccctgtgtattttatggagaggaattatgagatg
cccagaggggacacatccagcctaaggtatgattttcgctacagtgaggatcgagagcag
gtgcgggggtttgaggctgaggaagggttgatgctggcagcggatatcatgcggggggaa
gatttcacgcctgcggaggagttcgtgccccaggaggagctgggggctgccaagaaggtg
ccggctgaggaaggggtgatggaagaggcagagctggtgtcagaggagaccgagggctgg
gaggaggtggaactggagctggatgaggcaacgcggatgaacgtggtgacatcagccctg
gaggccagcggcttgggcccttcacacctggacatgaattatgtcctccagcagctggcc
aactggcaagatgcccattacaggcggcagctgaggtggaagatgctccagaaaggtgag
tgcccccacggggccctccctgccgccagccggacaagctgcagatcgtcgtgccgatga

DBGET integrated database retrieval system