KEGG   Homo sapiens (human): 901Help
Entry
901               CDS       T01001                                 

Gene name
CCNG2
Definition
cyclin G2
Orthology
K10146  
cyclin G2
Organism
hsa  Homo sapiens (human)
Pathway
FoxO signaling pathway
p53 signaling pathway
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:hsa04068]
Cellular Processes; Cell growth and death; p53 signaling pathway [PATH:hsa04115]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4q21.1
AA seq 344 aa AA seqDB search
MKDLGAEHLAGHEGVQLLGLLNVYLEQEERFQPREKGLSLIEATPENDNTLCPGLRNAKV
EDLRSLANFFGSCTETFVLAVNILDRFLALMKVKPKHLSCIGVCSFLLAARIVEEDCNIP
STHDVIRISQCKCTASDIKRMEKIISEKLHYELEATTALNFLHLYHTIILCHTSERKEIL
SLDKLEAQLKACNCRLIFSKAKPSVLALCLLNLEVETLKSVELLEILLLVKKHSKINDTE
FFYWRELVSKCLAEYSSPECCKPDLKKLVWIVSRRTAQNLHNSYYSVPELPTIPEGGCFD
ESESEDSCEDMSCGEESLSSSPPSDQECTFFFNFKVAQTLCFPS
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaaggatttgggggcagagcacttggcaggtcatgaaggggtccaacttctcgggttg
ttgaacgtctacctggaacaagaagagagattccaacctcgagaaaaagggctgagtttg
attgaggctaccccggagaatgataacactttgtgtccaggattgagaaatgccaaagtt
gaagatttaaggagtttagccaacttttttggatcttgcactgaaacttttgtcctggct
gtcaatattttggacaggttcttggctcttatgaaggtgaaacctaaacatttgtcttgc
attggagtctgttcttttttgctggctgctagaatagttgaagaagactgcaatattcca
tccactcatgatgtgatccggattagtcagtgtaaatgtactgcttctgacataaaacgg
atggaaaaaataatttcagaaaaattgcactatgaattggaagctactactgccttaaac
tttttgcacttataccatactattatactttgtcatacttcagaaaggaaagaaatactg
agccttgataaactagaagctcagctgaaagcttgcaactgccgactcatcttttcaaaa
gcaaaaccatctgtattagccttgtgccttctcaatttggaagtggaaactttgaaatct
gttgaattactggaaattctcttgctagttaaaaaacattccaagattaatgacactgag
ttcttctactggagagagttggtttctaaatgcctagccgagtattcttctcctgaatgt
tgcaaaccagatcttaagaagttggtttggatcgtttcaaggcgcacagcccagaacctc
cacaacagctactatagtgttcctgagctgccaacgatacctgaggggggttgttttgat
gaaagtgaaagtgaggactcttgtgaagatatgagttgtggagaggagagtctcagcagc
tctcctcccagtgatcaagagtgcaccttctttttcaacttcaaagtggcacaaacactg
tgctttccatcttag

DBGET integrated database retrieval system