KEGG   Homo sapiens (human): 90134Help
Entry
90134             CDS       T01001                                 

Gene name
KCNH7, ERG3, HERG3, Kv11.3
Definition
(RefSeq) potassium voltage-gated channel subfamily H member 7
  KO
K04910  
potassium voltage-gated channel Eag-related subfamily H member 7
Organism
hsa  Homo sapiens (human)
Drug target
Flecainide (DG00201): 
Brite
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  K+ channel, KCNH, Kv10-12.x (Ether-a-go-go)
   90134 (KCNH7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q24.2
AA seq 1196 aa AA seqDB search
MPVRRGHVAPQNTFLGTIIRKFEGQNKKFIIANARVQNCAIIYCNDGFCEMTGFSRPDVM
QKPCTCDFLHGPETKRHDIAQIAQALLGSEERKVEVTYYHKNGSTFICNTHIIPVKNQEG
VAMMFIINFEYVTDNENAATPERVNPILPIKTVNRKFFGFKFPGLRVLTYRKQSLPQEDP
DVVVIDSSKHSDDSVAMKHFKSPTKESCSPSEADDTKALIQPSKCSPLVNISGPLDHSSP
KRQWDRLYPDMLQSSSQLSHSRSRESLCSIRRASSVHDIEGFGVHPKNIFRDRHASEDNG
RNVKGPFNHIKSSLLGSTSDSNLNKYSTINKIPQLTLNFSEVKTEKKNSSPPSSDKTIIA
PKVKDRTHNVTEKVTQVLSLGADVLPEYKLQTPRINKFTILHYSPFKAVWDWLILLLVIY
TAIFTPYSAAFLLNDREEQKRRECGYSCSPLNVVDLIVDIMFIIDILINFRTTYVNQNEE
VVSDPAKIAIHYFKGWFLIDMVAAIPFDLLIFGSGSDETTTLIGLLKTARLLRLVRVARK
LDRYSEYGAAVLMLLMCIFALIAHWLACIWYAIGNVERPYLTDKIGWLDSLGQQIGKRYN
DSDSSSGPSIKDKYVTALYFTFSSLTSVGFGNVSPNTNSEKIFSICVMLIGSLMYASIFG
NVSAIIQRLYSGTARYHMQMLRVKEFIRFHQIPNPLRQRLEEYFQHAWTYTNGIDMNMVL
KGFPECLQADICLHLNQTLLQNCKAFRGASKGCLRALAMKFKTTHAPPGDTLVHCGDVLT
ALYFLSRGSIEILKDDIVVAILGKNDIFGEMVHLYAKPGKSNADVRALTYCDLHKIQRED
LLEVLDMYPEFSDHFLTNLELTFNLRHESAKADLLRSQSMNDSEGDNCKLRRRKLSFESE
GEKENSTNDPEDSADTIRHYQSSKRHFEEKKSRSSSFISSIDDEQKPLFSGIVDSSPGIG
KASGLDFEETVPTSGRMHIDKRSHSCKDITDMRSWERENAHPQPEDSSPSALQRAAWGIS
ETESDLTYGEVEQRLDLLQEQLNRLESQMTTDIQTILQLLQKQTTVVPPAYSMVTAGSEY
QRPIIQLMRTSQPEASIKTDRSFSPSSQCPEFLDLEKSKLKSKESLSSGVHLNTASEDNL
TSLLKQDSDLSLELHLRQRKTYVHPIRHPSLPDSSLSTVGIVGLHRHVSDPGLPGK
NT seq 3591 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtgcgcagggggcatgtggcaccacaaaatacatttctggggaccatcattcgg
aaatttgaagggcaaaataaaaaatttatcattgcaaatgccagagtgcagaactgtgcc
atcatttattgcaacgatgggttctgtgagatgactggtttctccaggccagatgtcatg
caaaagccatgcacctgcgactttctccatggacccgagaccaagaggcatgatattgcc
caaattgcccaggcattgctggggtcagaagagaggaaagtggaggtcacctactatcac
aaaaatgggtccacttttatttgtaacactcacataattccagtgaaaaaccaagagggc
gtggctatgatgttcatcattaattttgaatatgtgacggataatgaaaacgctgccacc
ccagagagggtaaacccaatattaccaatcaaaactgtaaaccggaaattttttgggttc
aaattccctggtctgagagttctcacttacagaaagcagtccttaccacaagaagacccc
gatgtggtggtcatcgattcatctaaacacagtgatgattcagtagccatgaagcatttt
aagtctcctacaaaagaaagctgcagcccctctgaagcagatgacacaaaagctttgata
cagcccagcaaatgttctcccttggtgaatatatccggacctcttgaccattcctctccc
aaaaggcaatgggaccgactctaccctgacatgctgcagtcaagttcccagctgtcccat
tccagatcaagggaaagcttatgtagtatacggagagcatcttcggtccatgatatagaa
ggattcggcgtccaccccaagaacatatttagagaccgacatgccagcgaagacaatggt
cgcaatgtcaaagggccttttaatcatatcaagtcaagcctcctgggatccacatcagat
tcaaacctcaacaaatacagcaccattaacaagattccacagctcactctgaatttttca
gaggtcaaaactgagaaaaagaattcatcacctccttcttcagataaaaccattattgca
cccaaggttaaagatcgaacacacaatgtgactgagaaagtgacccaggttctctcttta
ggagcagatgtcctacctgaatacaaactgcagacaccacgcatcaacaagtttacgata
ttgcactacagccctttcaaggcagtctgggactggcttatcctgctgttggtcatatac
actgctatatttactccctactctgcagccttcctcctcaatgacagagaagaacagaaa
agacgagaatgtggctattcttgtagccctttgaatgtggtagacttgattgtggatatt
atgtttatcatagatattttaataaacttcagaacaacatatgtaaatcagaatgaagaa
gtggtaagtgatcccgccaaaatagcaatacactacttcaaaggctggttcctgattgac
atggttgcagcaattccttttgacttgctgatttttggatcaggttctgatgagacaaca
acattaattggtcttttgaagactgcccgactcctccgtcttgtgcgcgtggccaggaaa
ctggatcgatattcagaatatggcgctgctgttctaatgctcttaatgtgcatctttgcc
ctgattgctcactggctggcttgcatttggtatgcgattgggaatgtagaaaggccttac
ctgactgacaaaatcggatggttggattccttaggacagcaaattgggaaacgttacaat
gacagtgactcaagttctggaccatccattaaagacaaatacgtcacagcactttatttt
accttcagcagtttaaccagtgtaggattcgggaatgtgtctcctaacacgaattcggag
aaaatcttttcaatttgtgtcatgttgattggctcactaatgtatgcaagcatttttggg
aatgtatctgcaattatccaaagactatactcgggaactgccaggtaccacatgcagatg
ctgcgagtaaaagagttcattcgctttcaccaaatccccaaccctctgaggcaacgtctt
gaagaatatttccagcacgcatggacttacaccaatggcattgacatgaacatggtccta
aagggtttcccagaatgcttacaagcagacatttgtctacatctcaaccagacattgctg
caaaactgcaaagcctttcggggggcaagtaaaggttgccttagagctttggcaatgaag
ttcaaaaccacccatgcacctccaggagacaccctcgttcactgtggggatgtcctcact
gcactttatttcttatccagaggctccattgaaattctcaaagatgacattgtggtggct
attctgggaaaaaatgatatatttggagaaatggttcatctttatgccaaacctggaaag
tctaatgcagatgtaagagccctcacatactgtgacttgcataagattcagcgagaagac
ttgttagaggttttggatatgtatcctgagttttctgatcactttctaacaaacctagag
ttgactttcaacctaaggcatgagagcgcaaaggctgatctcctacgatcacaatccatg
aatgattcagaaggagacaactgtaaactaagaagaaggaaattgtcatttgaaagtgaa
ggagagaaagaaaacagtacaaatgatcctgaagactctgcagataccataagacattat
cagagttccaagagacactttgaagagaaaaaaagcagatcctcatctttcatctcctcc
attgatgatgaacaaaagccgctcttctcaggaatagtagactcttctccaggaataggg
aaagcatctgggctcgattttgaagaaacagtgcccacctcaggaagaatgcacatagat
aaaagaagtcactcttgcaaagatatcactgacatgcgaagctgggaacgagaaaatgca
catccccagcctgaagactccagtccatctgcacttcagcgagctgcctggggtatctct
gaaaccgaaagcgacctcacctacggggaagtggaacaaagattagatctgctccaggag
caacttaacaggcttgaatcccaaatgaccactgacatccagaccatcttacagttgctg
cagaaacaaaccactgtggtccccccagcctacagtatggtaacagcaggatcagaatat
cagagacccatcatccagctgatgagaaccagtcaaccggaagcatccatcaaaactgac
cgaagtttcagcccttcctcacaatgtcctgaatttctagaccttgaaaaatctaaactt
aaatccaaagaatccctttcaagtggggtgcatctgaacacagcttcagaagacaacttg
acttcacttttaaaacaagacagtgatctctctttagagcttcacctgcggcaaagaaaa
acttacgttcatccaattaggcatccttctttgccagattcatccctaagcactgtagga
atcgtgggtcttcataggcatgtttctgatcctggtcttccagggaaataa

DBGET integrated database retrieval system