KEGG   Homo sapiens (human): 90161Help
Entry
90161             CDS       T01001                                 

Gene name
HS6ST2
Definition
heparan sulfate 6-O-sulfotransferase 2 (EC:2.8.2.-)
Orthology
K08102  
heparan sulfate 6-O-sulfotransferase HS6ST2 [EC:2.8.2.-]
Organism
hsa  Homo sapiens (human)
Pathway
Glycosaminoglycan biosynthesis - heparan sulfate / heparin
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00534 Glycosaminoglycan biosynthesis - heparan sulfate / heparin
    90161 (HS6ST2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.2  Sulfotransferases
    2.8.2.-  
     90161 (HS6ST2)
Glycosyltransferases [BR:hsa01003]
 Unclassified
  Sulfotransferases
   90161 (HS6ST2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xq26.2
AA seq 645 aa AA seqDB search
MALPACAVREFEPPRQPERGAPVRTTCPRRHSRVEAELAASRPGSVAASVRAGPPRGVSH
GFHTRPLLDKPRKASSSLAGAACAPLFALLSRGRRRRMHVLRRRWDLGSLCRALLTRGLA
ALGHSLKHVLGAIFSKIFGPMASVGNMDEKSNKLLLALVMLFLFAVIVLQYVCPGTECQL
LRLQAFSSPVPDPYRSEDESSARFVPRYNFTRGDLLRKVDFDIKGDDLIVFLHIQKTGGT
TFGRHLVRNIQLEQPCECRVGQKKCTCHRPGKRETWLFSRFSTGWSCGLHADWTELTSCV
PSVVDGKRDARLRPSRWRIFQILDAASKDKRGSPNTNAGANSPSSTKTRNTSKSGKNFHY
ITILRDPVSRYLSEWRHVQRGATWKASLHVCDGRPPTSEELPSCYTGDDWSGCPLKEFMD
CPYNLANNRQVRMLSDLTLVGCYNLSVMPEKQRNKVLLESAKSNLKHMAFFGLTEFQRKT
QYLFEKTFNMNFISPFTQYNTTRASSVEINEEIQKRIEGLNFLDMELYSYAKDLFLQRYQ
FMRQKEHQEARRKRQEQRKFLKGRLLQTHFQSQGQGQSQNPNQNQSQNPNPNANQNLTQN
LMQNLTQSLSQKENRESPKQNSGKEQNDNTSNGTNDYIGSVEKWR
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atggcactgcctgcgtgtgcagtccgggagttcgagccgccgcggcaaccggagcgagga
gcgcccgtccgcaccacctgtccccgccggcattccagagtagaggccgaattggcagcg
agccggcccgggtcggtcgccgcctcagttcgcgcgggccctcctaggggtgtgtctcac
ggattccacacccggccgctcctggacaagccccgaaaggcgtcttcttccctggcggga
gccgcgtgcgccccgcttttcgcgctgctgtcccggggccgccgcaggcggatgcacgtc
ctcaggcgacgctgggacctgggctccctctgccgggccctgctcactcggggcctggcc
gccctgggccactcgctgaagcacgtgctcggtgcgatcttctccaagattttcggcccc
atggccagcgtcgggaacatggatgagaaatccaacaagctgctgctagctttggtgatg
ctcttcctatttgccgtgatcgtcctccaatacgtgtgccccggcacagaatgccagctc
ctccgcctgcaggcgttcagctccccggtgccggacccgtaccgctcggaggatgagagc
tccgccaggttcgtgccccgctacaatttcacccgcggcgacctcctgcgcaaggtagac
ttcgacatcaagggcgatgacctgatcgtgttcctgcacatccagaagaccgggggcacc
actttcggccgccacttggtgcgtaacatccagctggagcagccgtgcgagtgccgcgtg
ggtcagaagaaatgcacttgccaccggccgggtaagcgggaaacctggctcttctccagg
ttctccacgggctggagctgcgggttgcacgccgactggaccgagctcaccagctgtgtg
ccctccgtggtggacggcaagcgcgacgccaggctgagaccgtccaggtggaggattttt
cagattctagatgcagcaagtaaggataaacggggttctccaaacactaacgcaggcgcc
aactctccgtcatccacaaagacccggaacacatctaagagtgggaagaacttccactac
atcaccatcctccgagacccagtgtcccggtacttgagtgagtggaggcatgtccagaga
ggggcaacatggaaagcatccctgcatgtctgcgatggaaggcctccaacctccgaagag
ctgcccagctgctacactggcgatgactggtctggctgccccctcaaagagtttatggac
tgtccctacaatctagccaacaaccgccaggtgcgcatgctctccgacctgaccctggta
ggctgctacaacctctctgtcatgcctgaaaagcaaagaaacaaggtccttctggaaagt
gccaagtcaaatctgaagcacatggcgttcttcggcctcactgagtttcagcggaagacc
caatatctgtttgagaaaaccttcaacatgaactttatttcgccatttacccagtataat
accactagggcctctagtgtagagatcaatgaggaaattcaaaagcgtattgagggactg
aattttctggatatggagttgtacagctatgccaaagacctttttttgcagaggtatcag
tttatgaggcagaaagagcatcaggaggccaggcgaaagcgtcaggaacaacgcaaattt
ctgaagggaaggctccttcagacccatttccagagccagggtcagggccagagccagaat
ccgaatcagaatcagagtcagaacccaaatccgaatgccaatcagaacctgactcagaat
ctgatgcagaatctgactcagagtttgagccagaaggagaaccgggaaagcccgaagcag
aactcaggcaaggagcagaatgataacaccagcaatggcaccaacgactacataggcagt
gtagagaaatggcgttaa

DBGET integrated database retrieval system