KEGG   Homo sapiens (human): 90167Help
Entry
90167             CDS       T01001                                 

Gene name
FRMD7, NYS, NYS1, XIPAN
Definition
(RefSeq) FERM domain containing 7
Organism
hsa  Homo sapiens (human)
Disease
H00776  
Congenital motor nystagmus (CMN)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xq26.2
AA seq 699 aa AA seqDB search
MLHLKVQFLDDSQKIFVVDQKSSGKALFNLSCSHLNLAEKEYFGLEFCSHSGNNVWLELL
KPITKQVKMDPGHLREELTRYLFTLQIKKDLALGRLPCSDNCTALMVSHILQSELGDFHE
ETDRKHLAQTRYLPNQDCLEGKIMHFHQKHIGRSPAESDILLLDIARKLDMYGIRPHPAS
DGEGMQIHLAVAHMGVLVLRGNTKINTFNWAKIRKLSFKRKHFLIKLHANILVLCKDTLE
FTMASRDACKAFWKTCVEYHAFFRLSEEPKSKPKTLLCSKGSSFRYSGRTQRQLLEYGRK
GRLKSLPFERKHYPSQYHERQCRSSPDLLSDVSKQVEDLRLAYGGGYYQNVNGVHASEPV
LESRRRNSALEVTFATELEHSKPEADPTLLHQSQSSSSFPFIYMDPVFNTEPNPNPDPRD
IFSERSSLSSFQTSCKFSGNHMSIYSGLTSKVRPAKQLTYTDVPYIPCTGQQVGIMPPQV
FFYVDKPPQVPRWSPIRAEERTSPHSYVEPTAMKPAERSPRNIRMKSFQQDLQVLQEAIA
RTSGRSNINVGLEEEDPNLEDAFVCNIQEQTPKRSQSQSDMKTIRFPFGSEFRPLGPCPA
LSHKADLFTDMFAEQELPAVLMDQSTAERYVASESSDSESEILKPDYYALYGKEIRSPMA
RIRLSSGSLQLDEEDEDAYFNTPTAEDRTSLKPCNYFLA
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atgctacatttaaaagtgcagtttttggatgattcccagaagatttttgtggttgatcaa
aagtcatccgggaaggcattgtttaacctgagttgcagccatctaaatcttgctgaaaag
gaatattttggattagaattctgcagccattctggaaataatgtttggctggagcttttg
aagcccataacaaagcaggtaaaaatggaccctggacatctgcgggaagaacttacaagg
tatctttttactcttcaaataaagaaggatttggctctaggaaggcttccatgcagtgac
aactgtacagcgttgatggtatctcacatcttacaatcagaacttggagactttcatgaa
gaaacagataggaagcatctggcacaaactcggtacttaccaaaccaagactgtttagag
ggcaagatcatgcactttcatcagaagcacattggcaggagcccagctgaatctgacatt
ctgctactggacatagcaaggaagctggatatgtatggcatcaggcctcaccccgccagt
gatggtgaagggatgcagattcacctggctgttgctcacatgggagtactggtgttacgg
ggaaatacaaagatcaatacttttaactgggctaaaatccgcaagttgagttttaagaga
aagcattttctcatcaaacttcatgccaatatcttggtgttgtgcaaggataccttggag
ttcaccatggccagccgagatgcctgcaaggctttctggaagacttgtgtggaataccat
gctttcttcaggctttcggaagagcccaaatcaaagcccaaaaccctactctgcagcaag
ggttccagtttccgctatagtggacgaacccaaaggcaacttttggaatatgggagaaaa
gggaggctgaagagcttgccatttgaaaggaaacattacccatctcagtaccatgaacga
cagtgcaggtcctcaccagacctcctctctgatgtgtcaaaacaagtggaagatttgaga
ctagcatatggtggtggctactaccaaaatgtgaatggagtgcacgcatctgagccagtg
ctggagagtaggaggaggaattctgcattggaggtgacatttgcaactgagctggagcat
tccaaaccagaggcggatcccacattgctacatcagtcccaaagcagttcctctttccct
tttatttatatggaccctgtctttaacactgagcccaatcctaaccctgatcccagagac
attttttcagagaggagttctctaagctccttccaaacaagctgtaagttttctggtaat
cacatgagcatatattctggcctcacaagcaaagtgcgtccagcaaagcagctaacttac
acggatgtgccctatattccttgtacaggtcagcaggttggtattatgcctccccaggtc
tttttttatgtggacaagccaccccaggtgcccagatggtccccaattagagcagaggaa
aggacaagtccacatagctatgtagagcccactgcaatgaagccagctgaaagaagccca
aggaatatcagaatgaagagctttcagcaagacctgcaagtactccaagaagctatagcc
aggactagcggtaggagcaacatcaatgtaggtctagaagaggaagacccaaatttggaa
gatgcatttgtatgtaacattcaagagcaaacccctaaaaggtcccagagccaatcagac
atgaaaactattcgttttccttttgggtcagaatttagacctttagggccttgtcctgct
ctcagtcataaagcagacctgtttacggatatgtttgcagagcaggagttgccagcagtt
ctaatggatcaaagtacagcagaaaggtatgtagctagtgaatccagtgattctgaatca
gagattcttaaaccagactactatgctttgtatggcaaagaaataaggtcacccatggcc
agaatccgcctgtcttctggtagtctacagttagatgaagaagatgaagatgcttatttc
aacacaccaactgctgaagacaggacttcactaaaaccatgtaattactttttagcttaa

DBGET integrated database retrieval system